NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0100194_101728

Scaffold Ga0100194_101728


Overview

Basic Information
Taxon OID3300006447 Open in IMG/M
Scaffold IDGa0100194_101728 Open in IMG/M
Source Dataset NameMicrobial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture A4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAgriculture and Agri-Food Canada
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)785
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Animal Waste → Unclassified → Unclassified → Manure → Microbial Communities From Manure Storage Tank From Sherbrooke, Qc, Canada

Source Dataset Sampling Location
Location NameSherbrooke, QC, Canada
CoordinatesLat. (o)45.4Long. (o)-71.9Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043951Metagenome / Metatranscriptome155N

Sequences

Protein IDFamilyRBSSequence
Ga0100194_1017283F043951GAGGMEHLSLGRPIEASLGPRYQCPVCGQKLWTIQAPWTGWQEWYKTEDGRRHYKHSCNIMRDAHIAFRRMFGQDW*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.