NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006447

3300006447: Microbial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture A4



Overview

Basic Information
IMG/M Taxon OID3300006447 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117456 | Gp0123998 | Ga0100194
Sample NameMicrobial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture A4
Sequencing StatusPermanent Draft
Sequencing CenterAgriculture and Agri-Food Canada
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size47352842
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From Manure Storage Tank From Sherbrooke, Qc, Canada
TypeEngineered
TaxonomyEngineered → Solid Waste → Animal Waste → Unclassified → Unclassified → Manure → Microbial Communities From Manure Storage Tank From Sherbrooke, Qc, Canada

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationSherbrooke, QC, Canada
CoordinatesLat. (o)45.4Long. (o)-71.9Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004383Metagenome / Metatranscriptome440Y
F037272Metagenome / Metatranscriptome168Y
F043951Metagenome / Metatranscriptome155N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0100194_101728Not Available785Open in IMG/M
Ga0100194_104678Not Available2799Open in IMG/M
Ga0100194_148550Not Available1307Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0100194_101728Ga0100194_1017283F043951MEHLSLGRPIEASLGPRYQCPVCGQKLWTIQAPWTGWQEWYKTEDGRRHYKHSCNIMRDAHIAFRRMFGQDW*
Ga0100194_104678Ga0100194_1046782F037272MTRKQIMRVHTAAGVEEIDADRLLVQEDEYVLFQGEEEVRRVPIADVLSETDPETGEETGGIETIYSRS*
Ga0100194_148550Ga0100194_1485501F004383MSGDNLLERAFMARIRADELRAELKALQKEFDEREDVIALKRQIDRCDHERQTCIEQAQTTGVTKQGSFLLRERTRTVRTVIPWKFAEKFGLERFCRVANIPVGAAEKEVGKKDLEDVVEKSVTITGVSVEYERPEAEA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.