NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074425_100826

Scaffold Ga0074425_100826


Overview

Basic Information
Taxon OID3300005676 Open in IMG/M
Scaffold IDGa0074425_100826 Open in IMG/M
Source Dataset NameEnhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90903 Phage Sequencing
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Queensland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)21195
Total Scaffold Genes40 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (12.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Source Dataset Sampling Location
Location NameSt. Lucia, Queensland Australia
CoordinatesLat. (o)-27.49999Long. (o)153.012098Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007965Metagenome / Metatranscriptome341Y

Sequences

Protein IDFamilyRBSSequence
Ga0074425_10082630F007965AGGMKTKKQKETRGGKRSFSGRKKADYVTKTIAFRVRVEFVEPIKKMVKDYVSERLKGDA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.