NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005676

3300005676: Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90903 Phage Sequencing



Overview

Basic Information
IMG/M Taxon OID3300005676 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0111422 | Gp0115860 | Ga0074425
Sample NameEnhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90903 Phage Sequencing
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Queensland
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size23262446
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSt. Lucia, Queensland Australia
CoordinatesLat. (o)-27.49999Long. (o)153.012098Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003622Metagenome / Metatranscriptome476Y
F007965Metagenome / Metatranscriptome341Y
F034393Metagenome175Y
F043249Metagenome / Metatranscriptome156Y
F078533Metagenome / Metatranscriptome116Y
F082719Metagenome / Metatranscriptome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0074425_100826All Organisms → cellular organisms → Bacteria21195Open in IMG/M
Ga0074425_101055All Organisms → cellular organisms → Bacteria → Proteobacteria1213Open in IMG/M
Ga0074425_101995All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1108Open in IMG/M
Ga0074425_102237Not Available775Open in IMG/M
Ga0074425_102457All Organisms → cellular organisms → Bacteria2363Open in IMG/M
Ga0074425_105444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2126Open in IMG/M
Ga0074425_105611Not Available2943Open in IMG/M
Ga0074425_112740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus646Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0074425_100826Ga0074425_10082630F007965MKTKKQKETRGGKRSFSGRKKADYVTKTIAFRVRVEFVEPIKKMVKDYVSERLKGDA*
Ga0074425_101055Ga0074425_1010552F078533MTPDEFKRAREALCLSQNDLADVWGMGTNGGRTIRRWECWERPLNPIAAYCIALMLGEKAN*
Ga0074425_101995Ga0074425_1019951F034393MKAGYKINPSTTETLLYGCKIGEPNYMEEILFECKGYVNNDELMAKGKEWADKNGYDRLRISVVNLSTPPDFTNTVNI*
Ga0074425_102237Ga0074425_1022372F082719MGTRQQDYISGARAANRKIWEGINDLAAAQREWNALDYGTTLPTGEGANEGIQKAMVGAVVFDTANALVALLNTGHATNMAKLL*
Ga0074425_102457Ga0074425_1024571F078533MTPAEFKRARETLCLSQNDLAEVWGMGDNGGRTIRRWECGERPLNPIAAYCLQLML
Ga0074425_105444Ga0074425_1054441F043249MPKIVGTRERVHQPFYDSLIRVDGGTDLRVANVGPFGAVQARSQLFVRQGADLAVSNLTTGGFFPSDQTFITLAVRVWTYFRFNGEQQFVSGQGTFPVDSVAGLTSDRVMRVHKLYHQSQNQLFWQLVAGDKPQLTTFTAYTPFAGGLDGFFADSRLPRANNGVPTSSALMRLARPVLIPPRQGFQVVAIASPIGQSVGASIIEQLNGLNDLGPNGTSVPGADSIEKDIKYLIDGIHSRDVL*
Ga0074425_105611Ga0074425_1056113F082719MASRDEEFVTEAREANRKIWDGINALIALQRQWNALDYGNTLAVDGVVAAEVGAVVFDTATAFVAVLNAGHATNMAKLL*
Ga0074425_112740Ga0074425_1127402F003622MRSYKKELEAIANDLLTQNAEAIGNENKPNYSNKDFMNATIIFQTALMDKMYDNQDYDGMSVEDRMKMAESCGLALRKLIHTYTGLD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.