Basic Information | |
---|---|
Taxon OID | 3300005627 Open in IMG/M |
Scaffold ID | Ga0077107_112665 Open in IMG/M |
Source Dataset Name | Crenothrix polyspora biofilm communities from Wolfenbuettel waterworks, Germany |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 823 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Crenothrix Polyspora → Crenothrix Polyspora Biofilm Communities From Wolfenbuettel Waterworks, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Germany: Wolfenb?ttel, Lower Saxony | |||||||
Coordinates | Lat. (o) | 52.149 | Long. (o) | 10.542 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F064859 | Metagenome | 128 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0077107_1126651 | F064859 | N/A | MKRIVMLAAALVIALGNEASARLGNTEDQVAALFGKPTDAGEPDSDGITTNMYKNRTGEYLALVQF* |
⦗Top⦘ |