NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0055498_10000514

Scaffold Ga0055498_10000514


Overview

Basic Information
Taxon OID3300004058 Open in IMG/M
Scaffold IDGa0055498_10000514 Open in IMG/M
Source Dataset NameWetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2913
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location
Location NameUSA: San Francisco Bay, California
CoordinatesLat. (o)38.000637Long. (o)-121.624207Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013143Metagenome / Metatranscriptome274Y
F051769Metagenome / Metatranscriptome143Y
F052442Metagenome / Metatranscriptome142Y

Sequences

Protein IDFamilyRBSSequence
Ga0055498_100005142F052442AGGAGGMARRSKTSGEPRIGRKDLQDPDRDVRSPRKGTVEPEADRSDREAGAGRPVQLDEEGRSRPLGADSPRPVDDAPVPK*
Ga0055498_100005147F051769GGAMNAHAASGRIAAAVVLAMGGLGLGLLLLGGRRSEPLPVARCPIHGIAYDAELEVCPDCAKTDAAGGKGGTR*
Ga0055498_100005149F013143AGGAGMLSRFVLGAVVGGIAVYVWGDEIRRFANTKSRTARLVAADTLKSVQSTAEEIFDSAKDQVSSTLQSGQDAIRPARASRER*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.