| Basic Information | |
|---|---|
| Taxon OID | 3300003876 Open in IMG/M |
| Scaffold ID | Ga0063039_1005005 Open in IMG/M |
| Source Dataset Name | 373A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Marine Microbiology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5194 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (12.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smoker Hydrothermal Chimney → Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051533 | Metagenome | 144 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063039_10050053 | F051533 | GGA | MEDIKTQPMQEKIIVGTSSLKDLAIYLSGVKDGKGSLQPLGTIVLEDLWNAIKYLQGDVRYTCPERDK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |