NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003876

3300003876: 373A



Overview

Basic Information
IMG/M Taxon OID3300003876 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111369 | Gp0096878 | Ga0063039
Sample Name373A
Sequencing StatusPermanent Draft
Sequencing CenterMax Planck Institute for Marine Microbiology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size143175104
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBlack Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smoker Hydrothermal Chimney → Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine black smoker biomeblack smokersea water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029285Metagenome / Metatranscriptome189Y
F051533Metagenome144Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0063039_1005005All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium5194Open in IMG/M
Ga0063039_1029113Not Available1432Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0063039_1005005Ga0063039_10050053F051533MEDIKTQPMQEKIIVGTSSLKDLAIYLSGVKDGKGSLQPLGTIVLEDLWNAIKYLQGDVRYTCPERDK*
Ga0063039_1029113Ga0063039_10291133F029285MGNLKNKADYSKYKCPYYHLDKECGHKLHGPEGYENTYSVWCPCGFRGPVFYLDPEELNLEKIDVGI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.