Basic Information | |
---|---|
Taxon OID | 3300003691 Open in IMG/M |
Scaffold ID | JT63_1016469 Open in IMG/M |
Source Dataset Name | Combined assembly of microbial communities in oil-polluted sediment from the Gulf of Mexico |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Argonne National Laboratory |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3527 |
Total Scaffold Genes | 17 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (35.29%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Marine Sediment → Oil-Polluted Seafloor Microbial Communities From The Gulf Of Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Mexico, USA | |||||||
Coordinates | Lat. (o) | 28.74511 | Long. (o) | -88.35914 | Alt. (m) | Depth (m) | 0 to .01 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F009686 | Metagenome / Metatranscriptome | 314 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JT63_101646912 | F009686 | N/A | MFEKSFQRPTNYFNLEEERQWAIDKSLGILDWQGDNLNTEDLLRYAEHYE* |
⦗Top⦘ |