NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SLW08_109052

Scaffold SLW08_109052


Overview

Basic Information
Taxon OID3300003654 Open in IMG/M
Scaffold IDSLW08_109052 Open in IMG/M
Source Dataset NameSubglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.8 micron filter
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)881
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica

Source Dataset Sampling Location
Location NameWest Antarctica
CoordinatesLat. (o)-84.24Long. (o)-153.694Alt. (m)Depth (m)800
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037095Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
SLW08_1090522F037095AGGAGMAKDINKDGKVTMLEEILAAAGTYARAFLSAAIALYMTGNTSPRDLLMGGFAAIAPVILKALSPNHKEYGFKSKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.