Basic Information | |
---|---|
Taxon OID | 3300003654 Open in IMG/M |
Scaffold ID | SLW08_101327 Open in IMG/M |
Source Dataset Name | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.8 micron filter |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3249 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | West Antarctica | |||||||
Coordinates | Lat. (o) | -84.24 | Long. (o) | -153.694 | Alt. (m) | Depth (m) | 800 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004727 | Metagenome / Metatranscriptome | 426 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SLW08_1013272 | F004727 | AGGAG | MKVNISYHDNESLTVEEIVKYAVSNYGKAARVEITPESGLAYDYIYHGLRQLITQEQVSLFYDTDSYQIDIKKLRADVLYKVTEILDSVIIDNEGRLTGI* |
⦗Top⦘ |