Basic Information | |
---|---|
Taxon OID | 3300003512 Open in IMG/M |
Scaffold ID | SACTD2sed_1010205 Open in IMG/M |
Source Dataset Name | Macrotidal river microbial communities from the South Alligator River system, Northern Australia - Sample CTD2 sed R1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1059 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Macrotidal River → Macrotidal River Microbial Communities From The South Alligator River System, Northern Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | River | |||||||
Coordinates | Lat. (o) | -12.2376 | Long. (o) | 132.4096 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F084832 | Metagenome / Metatranscriptome | 112 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SACTD2sed_10102051 | F084832 | GAGG | MRPDYATPEDFARWRSYAETLSNSALRYVIADARQAARNMRGFNETREGYYEDQAFTYADELARRRRHD* |
⦗Top⦘ |