| Basic Information | |
|---|---|
| Taxon OID | 3300003442 Open in IMG/M |
| Scaffold ID | ERB454_1012319 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0111447, Gp0111475, Gp0111489 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Los Angeles, University of Waikato |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 854 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole Sediment → Volcano-Associated Fumarole Microbial Communities From Mt. Erebus, Antarctica, That Are Thermophilic |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mt. Erebus, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.533333 | Long. (o) | 167.116667 | Alt. (m) | Depth (m) | 0 to .04 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038873 | Metagenome / Metatranscriptome | 165 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ERB454_10123192 | F038873 | N/A | FVGAPNESRLREIFGGSLLSRMVRKLPGIDIRVVASRADRPKRPGQ* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |