| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003442 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0075598 | Gp0111447 | Ga0059330 |
| Sample Name | Combined Assembly of Gp0111447, Gp0111475, Gp0111489 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of California, Los Angeles, University of Waikato |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 39702683 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Volcano-Associated Fumarole Microbial Communities From Mt. Erebus, Antarctica, That Are Thermophilic |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole Sediment → Volcano-Associated Fumarole Microbial Communities From Mt. Erebus, Antarctica, That Are Thermophilic |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Mt. Erebus, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.533333 | Long. (o) | 167.116667 | Alt. (m) | N/A | Depth (m) | 0 to .04 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038873 | Metagenome / Metatranscriptome | 165 | Y |
| F042051 | Metagenome / Metatranscriptome | 159 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| ERB454_1012319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 854 | Open in IMG/M |
| ERB454_1024611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| ERB454_1012319 | ERB454_10123192 | F038873 | FVGAPNESRLREIFGGSLLSRMVRKLPGIDIRVVASRADRPKRPGQ* |
| ERB454_1024611 | ERB454_10246111 | F042051 | MTTFGEISWNDDVFVGSDNGKKNNNKDLFLRLEEGSNEMRLVTQPYQYLVHKFKKDPNNPRDFGQKVGCSSIHGSCPLCADGEKAKPRWLIGVISRKSGTYKILDISFAVFSQIRKLARNTQRWGDPTKYDIDIVVDKNGGATGYYSVQPISKEPLSAADQKIKDDADLEDLKRRVTPLTPDQVQKRIDRIMSLGDAASAATAPAT |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |