NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold U2draft_1000034

Scaffold U2draft_1000034


Overview

Basic Information
Taxon OID3300003278 Open in IMG/M
Scaffold IDU2draft_1000034 Open in IMG/M
Source Dataset NameDown-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - U2-648F-DHS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)258769
Total Scaffold Genes217 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)44 (20.28%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor → Down-Flow Hanging Sponge Reactor Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa

Source Dataset Sampling Location
Location NameUSA: University of Illionis
CoordinatesLat. (o)40.114056Long. (o)-88.226756Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002819Metagenome / Metatranscriptome528Y
F017846Metagenome / Metatranscriptome238Y

Sequences

Protein IDFamilyRBSSequence
U2draft_1000034152F002819N/AMPTTTCELAGTVYQLDYTKMSSKRGTYYFGKIHSSPVTGFAFTALTAGGHEFDDSREPFQRQEAIVSAIKNHESQ*
U2draft_1000034160F017846N/AMPVPFKIAITKEIIAHCKNCGTVSESDKIENSCAIAFALANIFPKVYVTNHCIFPFGIDGNKEKEIKIPLPLIAQQFIKLFDGFRLTPKLRLLLPDFEFIIDIPEEAIEHINIDEVRGLFKAGNDKERIATHHHHLRQLV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.