Basic Information | |
---|---|
Taxon OID | 3300003079 Open in IMG/M |
Scaffold ID | Ga0052158_10001 Open in IMG/M |
Source Dataset Name | Acid Mine Drainage microbial communities from Carnoules, Gard, France, bin 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 478350 |
Total Scaffold Genes | 495 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 328 (66.26%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Carnoules, Gard, France |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Carnoules, Gard, France | |||||||
Coordinates | Lat. (o) | 43.303 | Long. (o) | 6.188 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053270 | Metagenome / Metatranscriptome | 141 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0052158_10001156 | F053270 | N/A | VQALLPTIGKGAPVAGRKIFLRFAQASDVERLTREGVITAPPPAKETWNQRIVRWLSEQRAGRRAVLVAEDATGLLGILHLVFDLPVGFKDPEAANGFDIAMIEGLHLRAGVPPEVGNEMVEEIQRIATKRNVTTLTFCIPMNQPRAIRQVKEWGFEEFRIMAEPSKMLAFFRKTV* |
⦗Top⦘ |