NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003079

3300003079: Acid Mine Drainage microbial communities from Carnoules, Gard, France, bin 1



Overview

Basic Information
IMG/M Taxon OID3300003079 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0063632 | Gp0052268 | Ga0052158
Sample NameAcid Mine Drainage microbial communities from Carnoules, Gard, France, bin 1
Sequencing StatusPermanent Draft
Sequencing CenterCEA Genoscope
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size2539671
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAcid Mine Drainage Microbial Communities From Carnoules, Gard, France
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Carnoules, Gard, France

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → acid mine drainage → acidic water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationCarnoules, Gard, France
CoordinatesLat. (o)43.303Long. (o)6.188Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053270Metagenome / Metatranscriptome141Y
F095037Metagenome105Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0052158_10001All Organisms → cellular organisms → Bacteria478350Open in IMG/M
Ga0052158_10019All Organisms → cellular organisms → Bacteria546723Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0052158_10001Ga0052158_10001156F053270VQALLPTIGKGAPVAGRKIFLRFAQASDVERLTREGVITAPPPAKETWNQRIVRWLSEQRAGRRAVLVAEDATGLLGILHLVFDLPVGFKDPEAANGFDIAMIEGLHLRAGVPPEVGNEMVEEIQRIATKRNVTTLTFCIPMNQPRAIRQVKEWGFEEFRIMAEPSKMLAFFRKTV*
Ga0052158_10019Ga0052158_10019269F095037MGLPTHLNYLKRHGIAVHGGDVLEWFVRVGEGIVVNDLTILRDHEVAEIVEMIPGRIYALDLFKAWEGVFFTEEQCVYLGVWFDNVRNLRSDGQTGLAILGLWRVFCYWLQKAQEPDEMPDLPPSELAWHYIRQSERWVASNMRRNTVRQSDVMQTLERQRADALLFAPPPRNALHHADPRIWMWEAWWQGNPYFTLEHAYRDTLFGARSNDPAAYQRSIAGILSEAGEYPLLIVATNESRLGEIEPIVRNARAKVECYAPNESEIYLIATA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.