NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold draft_102310

Scaffold draft_102310


Overview

Basic Information
Taxon OID3300002848 Open in IMG/M
Scaffold IDdraft_102310 Open in IMG/M
Source Dataset NamePDIso5.158Aa3July202012
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)598671
Total Scaffold Genes523 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)416 (79.54%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Tepid (25-34C) → Sediment → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameNew Zealand
CoordinatesLat. (o)-38.358926Long. (o)176.368682Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004004Metagenome / Metatranscriptome457Y

Sequences

Protein IDFamilyRBSSequence
draft_102310505F004004AGGAGMTKAKTMRMPGKERPAASRLVIQRPPTTEPHHRNLCRNTKPSAGQPIRQTAEGLDYRFLWSLPRVIGPGSLCKARPRQSDYNANTQANGLNINATHIALRTYTLTR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.