NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold PetF_10014075

Scaffold PetF_10014075


Overview

Basic Information
Taxon OID3300002734 Open in IMG/M
Scaffold IDPetF_10014075 Open in IMG/M
Source Dataset NameMicrobial sample from Petrosia ficiformis
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4492
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Petrosia Ficiformis → Petrosia Ficiformis Microbial Communities From Milos, Greece

Source Dataset Sampling Location
Location NameMilos,Greece
CoordinatesLat. (o)36.76759Long. (o)24.51422Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097867Metagenome104Y

Sequences

Protein IDFamilyRBSSequence
PetF_100140755F097867N/AMLDTGDMLWIPPGCSHRNIGDMLTTRIILYTRNPLTLSQEYSSRAERVAGAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.