Basic Information | |
---|---|
Taxon OID | 3300002293 Open in IMG/M |
Scaffold ID | JGI24504J29685_1011005 Open in IMG/M |
Source Dataset Name | Biogas fermentation microbial communities from Germany - Plant 4 RNA1 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1416 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bielefeld, North Rhine-Westphalia, Germany | |||||||
Coordinates | Lat. (o) | 52.0385 | Long. (o) | 8.4956 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022893 | Metagenome / Metatranscriptome | 212 | N |
F023320 | Metagenome / Metatranscriptome | 210 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI24504J29685_10110052 | F022893 | AGAAG | MKLKKSKKLTISYKVKVKHFEDFLRLCSYDKTDVDGFINLLSKCTEVDKEIFYNLRFADLIRFVDELVDSVDKEMYKAPKKAIKVGERYYKLIDLLNLQVAFYVDFDLVEKTPSYLLALCYTETGTYTDERNSSVDEREKIMQNADVIDYMRLANFFLTWRDFLKKLKEIQKN* |
JGI24504J29685_10110054 | F023320 | GAGG | MKQYKALTFEVDLSGLGKEQWIQEELDYDTIAQKIIDTLIDVMREKDVEASSNLIQSLEPETKSGEIVIYADYYWKFIDKGVNGLLQNRNSEFSFKFVPASKKXAXSIAKWXEXRGLATEFTTLADAYRVATATKIKGIR |
⦗Top⦘ |