NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold M1t6BS2105N_1309943

Scaffold M1t6BS2105N_1309943


Overview

Basic Information
Taxon OID3300002224 Open in IMG/M
Scaffold IDM1t6BS2105N_1309943 Open in IMG/M
Source Dataset NameMarine microbial communities from the Baltic Sea - M1t6 BS2 (105N)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterKarolinska Institutet
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1399
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)58.133Long. (o)10.0Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028322Metagenome192N

Sequences

Protein IDFamilyRBSSequence
M1t6BS2105N_13099432F028322N/AMINMKLLDFWGSFQTNEKRMIKILLFLLPLIVVFIYLGDISNKISAKKLNLEVAKANFDYVYDKALNFQKYSLAQKALFDYPEKKDFIFSESKRYPLIDFQLGEEEGIMFIVFKSESVVNYAQFLESLVNHPEIEIISLSITPNSEFQQVKAFLQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.