NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LBB32012_10037381

Scaffold LBB32012_10037381


Overview

Basic Information
Taxon OID3300002039 Open in IMG/M
Scaffold IDLBB32012_10037381 Open in IMG/M
Source Dataset NameDelisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_B3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1526
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Source Dataset Sampling Location
Location NameLong Bay, Sydney, Australia
CoordinatesLat. (o)-33.57Long. (o)151.15Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078742Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
LBB32012_100373814F078742GGAGVEQLSVGTGSDLIDYGRLEVKEDGSWDVLASSSLAEEGVEGIVSSSDGLIRWHLTVWLDTVLKAEQFPTGVTNLNTSLSDMD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.