Scaffold LBB22012_10022544

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LBB22012_10022544

Scaffold LBB22012_10022544

Overview

Basic Information
Taxon OID	3300002035 Open in IMG/M
Scaffold ID	LBB22012_10022544 Open in IMG/M
Source Dataset Name	Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_B2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1669
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Source Dataset Sampling Location
Location Name	Long Bay, Sydney, Australia
Coordinates	Lat. (^o)	-33.57	Long. (^o)	151.15	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047173	Metagenome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
LBB22012_100225443	F047173	N/A	MRIIETKVYHINEHPNKEKCFEWIRDNWHDLNQHSVDEIIKGIKALSDKIGGSFDYSISQYPDKGDHITFKDYDHEVLCRISAEDCPLTGYCWDIDLIQGLRTNNTSMVLDSLHSDTEYIYSDEGLYEMIESNEYEFDEEGSLV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.