x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300002035
3300002035: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_B2
Overview
| Basic Information |
| IMG/M Taxon OID | 3300002035 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0103015 | Gp0060392 | Ga0016927 |
| Sample Name | Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_B2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 568844424 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → Viruses → Predicted Viral | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information |
| Location | Long Bay, Sydney, Australia |
| Coordinates | Lat. (o) | -33.57 | Long. (o) | 151.15 | Alt. (m) | N/A | Depth (m) | 5 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F047173 | Metagenome | 150 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| LBB22012_10022544 | LBB22012_100225443 | F047173 | MRIIETKVYHINEHPNKEKCFEWIRDNWHDLNQHSVDEIIKGIKALSDKIGGSFDYSISQYPDKGDHITFKDYDHEVLCRISAEDCPLTGYCWDIDLIQGLRTNNTSMVLDSLHSDTEYIYSDEGLYEMIESNEYEFDEEGSLV* |
