NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MIS_10002822

Scaffold MIS_10002822


Overview

Basic Information
Taxon OID3300002026 Open in IMG/M
Scaffold IDMIS_10002822 Open in IMG/M
Source Dataset NameSinkhole freshwater microbial communities from Lake Huron, USA - Flux 5k+
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)20981
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (76.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us

Source Dataset Sampling Location
Location NameMiddle Island Sinkhole, Lake Huron Michigan, USA
CoordinatesLat. (o)45.19843Long. (o)-83.32721Alt. (m)Depth (m)23
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F104554Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
MIS_1000282222F104554AGGAGMTTYSEIESEYHRKSIIQEMDAIRLEEEAVKGRTLLDKSLALLGNLMISAGEKLRRRQHSMQEERSVKLVKVA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.