Basic Information | |
---|---|
Taxon OID | 3300001778 Open in IMG/M |
Scaffold ID | ACM18_1097078 Open in IMG/M |
Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3g |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 511 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Amazon River plume to Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 7.2875 | Long. (o) | -53.0005 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074468 | Metagenome / Metatranscriptome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ACM18_10970781 | F074468 | GAGG | MAVEIVKLAPESFRTIYLRKEDRVILRTETGRKIIIKRIIPDEWKPWKIY |
⦗Top⦘ |