NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074468

Metagenome / Metatranscriptome Family F074468

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074468
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 50 residues
Representative Sequence MAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPDEWKP
Number of Associated Samples 103
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 93.28 %
% of genes from short scaffolds (< 2000 bps) 89.92 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.513 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh
(19.328 % of family members)
Environment Ontology (ENVO) Unclassified
(41.176 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.395 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.05%    β-sheet: 13.51%    Coil/Unstructured: 82.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF11246Phage_gp53 84.87
PF12322T4_baseplate 1.68
PF08722Tn7_TnsA-like_N 1.68
PF05496RuvB_N 0.84
PF11056UvsY 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 0.84

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.48 %
UnclassifiedrootN/A2.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2022920000|QLn_FQAYR3Y01EWHL9All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194517Open in IMG/M
2225789001|2226150600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194522Open in IMG/M
2236876005|none_p170358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194519Open in IMG/M
3300000928|OpTDRAFT_10037084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941700Open in IMG/M
3300000928|OpTDRAFT_10159624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941293Open in IMG/M
3300000928|OpTDRAFT_10202443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941170Open in IMG/M
3300000928|OpTDRAFT_10206085All Organisms → Viruses → Predicted Viral1329Open in IMG/M
3300000929|NpDRAFT_10479488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194821Open in IMG/M
3300000930|BpDRAFT_10097459All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae2853Open in IMG/M
3300000930|BpDRAFT_10109543All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae4678Open in IMG/M
3300001778|ACM18_1097078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194511Open in IMG/M
3300007345|Ga0070752_1122577All Organisms → Viruses → Predicted Viral1092Open in IMG/M
3300007345|Ga0070752_1401548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194506Open in IMG/M
3300007539|Ga0099849_1339114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194536Open in IMG/M
3300007540|Ga0099847_1146757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194703Open in IMG/M
3300007540|Ga0099847_1253453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194504Open in IMG/M
3300007554|Ga0102820_1021701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941580Open in IMG/M
3300007557|Ga0102821_1120678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194666Open in IMG/M
3300007557|Ga0102821_1141977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194610Open in IMG/M
3300007644|Ga0102902_1256729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194513Open in IMG/M
3300007667|Ga0102910_1019060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941541Open in IMG/M
3300007667|Ga0102910_1059771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194875Open in IMG/M
3300007716|Ga0102867_1060262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941001Open in IMG/M
3300007960|Ga0099850_1144771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194959Open in IMG/M
3300007962|Ga0102907_1159247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194581Open in IMG/M
3300008259|Ga0114841_1263122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194549Open in IMG/M
3300009003|Ga0102813_1118911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194835Open in IMG/M
3300009003|Ga0102813_1133538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194780Open in IMG/M
3300009055|Ga0102905_1143362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194509Open in IMG/M
3300009086|Ga0102812_10482398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194677Open in IMG/M
3300009420|Ga0114994_10149843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941580Open in IMG/M
3300009436|Ga0115008_10538481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194836Open in IMG/M
3300009496|Ga0115570_10127949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941210Open in IMG/M
3300009512|Ga0115003_10428566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194776Open in IMG/M
3300009705|Ga0115000_10354173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194941Open in IMG/M
3300010150|Ga0098056_1151703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194782Open in IMG/M
3300010300|Ga0129351_1384092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194525Open in IMG/M
3300017719|Ga0181390_1070036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194988Open in IMG/M
3300017726|Ga0181381_1074259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194730Open in IMG/M
3300017749|Ga0181392_1135320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194725Open in IMG/M
3300017762|Ga0181422_1200925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194600Open in IMG/M
3300017762|Ga0181422_1231881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194549Open in IMG/M
3300017818|Ga0181565_10002251All Organisms → cellular organisms → Bacteria14736Open in IMG/M
3300017957|Ga0181571_10597528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194667Open in IMG/M
3300017958|Ga0181582_10904770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194519Open in IMG/M
3300017962|Ga0181581_10838408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194546Open in IMG/M
3300017967|Ga0181590_10597630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194755Open in IMG/M
3300017986|Ga0181569_10139948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941717Open in IMG/M
3300018041|Ga0181601_10352398Not Available799Open in IMG/M
3300018048|Ga0181606_10718489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194504Open in IMG/M
3300018049|Ga0181572_10165676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941445Open in IMG/M
3300018049|Ga0181572_10549677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194706Open in IMG/M
3300018410|Ga0181561_10550222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194515Open in IMG/M
3300018421|Ga0181592_10718752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194665Open in IMG/M
3300018424|Ga0181591_11149245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194520Open in IMG/M
3300019765|Ga0194024_1160934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194530Open in IMG/M
3300020055|Ga0181575_10499774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194653Open in IMG/M
3300020184|Ga0181573_10230739All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Emdodecavirus → Sinorhizobium virus N3964Open in IMG/M
3300020184|Ga0181573_10440034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194589Open in IMG/M
3300020189|Ga0181578_10141743All Organisms → Viruses → Predicted Viral1277Open in IMG/M
3300020191|Ga0181604_10282736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194762Open in IMG/M
3300020207|Ga0181570_10315349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194778Open in IMG/M
3300021185|Ga0206682_10107239All Organisms → Viruses → Predicted Viral1375Open in IMG/M
3300021185|Ga0206682_10171516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1007Open in IMG/M
3300021335|Ga0213867_1022258All Organisms → Viruses → Predicted Viral2575Open in IMG/M
3300021336|Ga0210307_1021861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941575Open in IMG/M
3300021364|Ga0213859_10214054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194890Open in IMG/M
3300021368|Ga0213860_10151304All Organisms → Viruses → Predicted Viral1022Open in IMG/M
3300021373|Ga0213865_10267902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194810Open in IMG/M
3300021425|Ga0213866_10568680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194532Open in IMG/M
3300022053|Ga0212030_1029251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194762Open in IMG/M
3300022068|Ga0212021_1069688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194721Open in IMG/M
3300022198|Ga0196905_1120718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194687Open in IMG/M
3300022822|Ga0222646_101842All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae4766Open in IMG/M
3300022900|Ga0255771_1020885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Emdodecavirus → Sinorhizobium virus N34359Open in IMG/M
3300022934|Ga0255781_10000610All Organisms → cellular organisms → Bacteria28796Open in IMG/M
3300022939|Ga0255754_10064600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1942080Open in IMG/M
3300023698|Ga0228682_1024031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194815Open in IMG/M
(restricted) 3300024255|Ga0233438_10063203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941817Open in IMG/M
(restricted) 3300024255|Ga0233438_10395192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194505Open in IMG/M
(restricted) 3300024261|Ga0233439_10100003All Organisms → Viruses → Predicted Viral1487Open in IMG/M
(restricted) 3300024261|Ga0233439_10375477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194589Open in IMG/M
3300024281|Ga0228610_1020488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194791Open in IMG/M
3300024294|Ga0228664_1100058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194625Open in IMG/M
3300024320|Ga0233398_1079545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194797Open in IMG/M
3300024329|Ga0228631_1040529All Organisms → Viruses1319Open in IMG/M
3300024332|Ga0228659_1034208All Organisms → Viruses1161Open in IMG/M
3300024348|Ga0244776_10167435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941588Open in IMG/M
3300024348|Ga0244776_10599432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194695Open in IMG/M
3300024413|Ga0233393_1109865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194586Open in IMG/M
3300025617|Ga0209138_1127462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194692Open in IMG/M
3300025658|Ga0209659_1229290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194502Open in IMG/M
3300025674|Ga0208162_1181272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194550Open in IMG/M
3300025701|Ga0209771_1204642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194568Open in IMG/M
3300025771|Ga0208427_1157083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194747Open in IMG/M
3300025880|Ga0209534_10447952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194544Open in IMG/M
3300025881|Ga0209309_10339947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194663Open in IMG/M
3300025892|Ga0209630_10354346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194649Open in IMG/M
3300026458|Ga0247578_1113015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194537Open in IMG/M
3300026503|Ga0247605_1021862All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae1589Open in IMG/M
3300027188|Ga0208921_1025811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194892Open in IMG/M
3300027220|Ga0208927_1065706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194622Open in IMG/M
3300027231|Ga0208172_1050161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194740Open in IMG/M
3300027233|Ga0208678_1092569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194575Open in IMG/M
3300027571|Ga0208897_1162307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194549Open in IMG/M
3300027751|Ga0208304_10260868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194613Open in IMG/M
3300027752|Ga0209192_10017778All Organisms → Viruses3614Open in IMG/M
3300027780|Ga0209502_10340962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194633Open in IMG/M
3300028008|Ga0228674_1205774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194630Open in IMG/M
3300028129|Ga0228634_1017706All Organisms → Viruses → Predicted Viral2225Open in IMG/M
3300028330|Ga0247601_1028726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194745Open in IMG/M
3300031622|Ga0302126_10130535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae950Open in IMG/M
3300031706|Ga0307997_10293204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194576Open in IMG/M
3300031851|Ga0315320_10896898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194546Open in IMG/M
3300032088|Ga0315321_10710009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194582Open in IMG/M
3300032373|Ga0316204_10673197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194753Open in IMG/M
3300033981|Ga0334982_0449980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194577Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh19.33%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine16.81%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater14.29%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.08%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.72%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine5.88%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater4.20%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.36%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.36%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.52%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.68%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.68%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.84%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.84%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.84%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.84%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.84%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine0.84%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.84%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.84%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.84%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2022920000Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled)EnvironmentalOpen in IMG/M
2225789001Saline water microbial communities from Qinghai Lake, Tibetan Plateau -Sample 11638EnvironmentalOpen in IMG/M
2236876005Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15mEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300001778Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3gEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007644Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007962Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02EnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020184Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020189Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020207Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022822Saline water microbial communities from Ace Lake, Antarctica - #293EnvironmentalOpen in IMG/M
3300022900Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaGEnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300022937Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaGEnvironmentalOpen in IMG/M
3300022939Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaGEnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300024281Seawater microbial communities from Monterey Bay, California, United States - 11DEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300024320Seawater microbial communities from Monterey Bay, California, United States - 38DEnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300024332Seawater microbial communities from Monterey Bay, California, United States - 73DEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024413Seawater microbial communities from Monterey Bay, California, United States - 21DEnvironmentalOpen in IMG/M
3300025617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025658Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027220Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027231Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027233Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028129Seawater microbial communities from Monterey Bay, California, United States - 42DEnvironmentalOpen in IMG/M
3300028330Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 76R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031706Marine microbial communities from David Island wharf, Antarctic Ocean - #36EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
QL_na_50233602022920000Saline WaterMAAVDEIILAPESFRTIYLRREDRVILRTENGRKIIVKRIIPEEWEAYRIYDYENTNKRK
22262451972225789001Saline WaterMAAVDEIILAPESFRTIYLRREDRVILRTENGRKNY
none_17035822236876005Marine EstuarineMAAVDDIILALESFRTIYLRREDRVILRTEQGRKIIVKRIIPEEWQPYRMYDYEYDLNENKKEYSCLTVNSLGLVN
OpTDRAFT_1003708443300000928Freshwater And MarineMAAIDDIILAPESFQTIYLRREDRVIMRTERGAKIIIKRIIP
OpTDRAFT_1015962433300000928Freshwater And MarineMAVDIVKLAPESFQTIYLRKEDRIVLRTEQGRKIIIKR
OpTDRAFT_1020244333300000928Freshwater And MarineMAVDIVKLAPESFQTIYLRKEDRIILRTEQGRKIIIKRIIPSEWRPWKVYDQELAENENKKEIFLI
OpTDRAFT_1020608533300000928Freshwater And MarineMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPDEWKPWKLYDQELADNNNKKEIFL
NpDRAFT_1047948843300000929Freshwater And MarineMAAVDDIILAPESFRTIYLRREDRVILRTEQGRKIIVKRIIPEEWQPYRMYDYEYD
BpDRAFT_1009745913300000930Freshwater And MarineMAVDIVKLAPESFRTIYLRKEDRVILRTEQGRKIIIKRI
BpDRAFT_1010954393300000930Freshwater And MarineMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRI
ACM18_109707813300001778Marine PlanktonMAVEIVKLAPESFRTIYLRKEDRVILRTETGRKIIIKRIIPDEWKPWKIY
Ga0070748_111704133300006920AqueousMAVDILKLSPESFRTLFLRKEDKIILRTEAGKRIVIKRIIPEEWIPYR
Ga0070752_112257713300007345AqueousMAAVDEILLAPESFRTIYLRREDRVIMRTEQGAKIIIKRIIPEEWEPYRIYEYEETLNNNKKEIYLF
Ga0070752_140154823300007345AqueousMAVNDIILAPESFRTIYLRREDRVILRTERGEKIIIKRIIPDDWVAYRIYEYEETINNNKKEIFLF
Ga0099849_133911423300007539AqueousMAVEEIILAPESFQTIYLRREDRVILRTESGRKIIVKRIIPDE*
Ga0099847_114675713300007540AqueousMAVDNIVLAPESFRTIYLRREDRVIMRTERGEKIIVKRVIPEDWIPVRI
Ga0099847_125345313300007540AqueousMNMAVDIIKLSPDSFRTIFLRKEDRIILRTEAGKRIIIKRIIPEEWIPYRIYDYERALNDNKKNIFL
Ga0102820_102170113300007554EstuarineMAAVDDIILAPESFRTIYLRREDRVILRTEQGRKIIVKRIIPEEWQPYRMYD
Ga0102821_112067813300007557EstuarineMAVDNIILAPESFRTIYLRKEDRVIMRTERGQKIIIKRIIPEDWVPYR
Ga0102821_114197713300007557EstuarineMAVDIIKLTPDSFLTIYLRREDRVILRTEQGRKIVIKRIIP
Ga0102902_125672923300007644EstuarineMAVDIVKLAPESFRTIYLRKEDRVILRTEQGRKIIIKRIIPEEWKPYRIYDYEIALNE
Ga0102910_101906033300007667EstuarineMAVDIIKLAPESFQTIYLRKEDRIILRTEQGRKIIIKRIIPSEWKPWKIYD
Ga0102910_105977113300007667EstuarineMAVDIIKLTPDSFLTIYLRREDRVILRTEQGRKIVIKRIIPEEWKAWRIYDNENAIN
Ga0102867_106026233300007716EstuarineMAAVDEILLAPESFRTIYLRREDRVIMRTEQGQKIIIR
Ga0099850_114477113300007960AqueousMAVEEIILAPESFRTIYLRREDRVILRTETGRKIIIKRIIPEEWEPYRIYDY
Ga0102907_115924713300007962EstuarineMAAGDEILLAPESFRTIYLRREDRVIMRTEQGQKIIIRRIIPEEWKPY
Ga0114841_126312223300008259Freshwater, PlanktonMATDIIKIAPNSFKTIFLRKEDRLILRTEAGRRIVLQRIVPEQWKAYRIYEY
Ga0102813_111891133300009003EstuarineMAVDIIKLTPDSFLTIYLRREDRVILRTEQGRKIVIKRIIPEEWKAWR
Ga0102813_113353833300009003EstuarineMAAVDDIILAPESFRTIYLRREDRVILRTEQGRKIIVKRIIPEEWQPYRMYDYEYDLNE
Ga0102905_114336223300009055EstuarineMAVDIIKLTPDSFLTIYLRREDRVILRTEQGRKIVIKRIIPEE
Ga0102812_1048239813300009086EstuarineMAVDIIKLAPESFQTIYLRKEDRIILRTEQGRKIIIKR
Ga0114994_1014984333300009420MarineMAVDNLILAPESFRTIYLRKEDRVIMRTERGQKIIIKRIIPEDWVPYRIFEYEE
Ga0115008_1053848133300009436MarineMAVDIVKLAPESFQTIYLRKEDRIILRTEQGRKIIIKRIIPAEWREWKVYDQELAE
Ga0115570_1012794913300009496Pelagic MarineMAVDNIILAPESFRTIYLRKEDRVIMRTERGQKIIIKRIVPEDWVPYRIFEYEEQ
Ga0115003_1042856613300009512MarineMAAIDDIILAPESFQTIYLRREDRVIMRTERGAKIIIKRIIPEEWKPYRIYDYEIALNEKKKEIFL
Ga0115000_1035417313300009705MarineMAVDNLILAPESFRTIYLRKEDRVIMRTERGQKIIIKRIIPEDWVP
Ga0098056_115170333300010150MarineMAVDNIILAPESFRTIYLRREDRVILRTERGQKIIVKRIIPDDWVPYRIF
Ga0129351_138409213300010300Freshwater To Marine Saline GradientMAVDQVILAPESFRTIYLRREDRVILLTEQGRKIIIKR
Ga0181390_107003633300017719SeawaterMAVDQVILAPESFRTIYLRKEDRVILRTERGRKIIIKRIIPDEWKEYRIY
Ga0181381_107425933300017726SeawaterMAAVDEILLAPESFRTIYLRREDRVILRTEQGAKIIIKRIIPDEWEPYRIYEYEQALNDNKK
Ga0181392_113532033300017749SeawaterMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPDEWKP
Ga0181422_120092523300017762SeawaterMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPNEWKPWRVYDQELADNNNKKEIFLV
Ga0181422_123188113300017762SeawaterMAVNDIILAPESFRTIYLRREDRVILRTERGQKIIVKRIIPDDWVPYR
Ga0181565_10002251253300017818Salt MarshMAVDEIILAPESFQTIYLRREDRVILRTEQGRKII
Ga0181571_1059752813300017957Salt MarshMAAVDEILLAPESFRTIYLRREDRVIMRTEQGAKII
Ga0181582_1090477023300017958Salt MarshMAVEIVKLAPESFRTIYLRKEDRVILRTETGRKIIIKRIIPDEWKPWKIYDEE
Ga0181581_1083840823300017962Salt MarshMAVEQVKLTADSFRTIYLRREDRVILRTETGVKIIIRRIIPDEWKPWRVYENEEALNDNK
Ga0181590_1059763013300017967Salt MarshMAIDIVKIAPESFRTIYLRKEDRIILRTEAGRKIII
Ga0181569_1013994833300017986Salt MarshMAAVDDIVLAPESFRTIYLRREDRVILRTERGQKIIVKRIIPEDWV
Ga0181601_1035239833300018041Salt MarshMAVDIIKLAPESFQTIYLRKEDRIILRTEQGRKIIIKRIIPDEWKP
Ga0181606_1071848913300018048Salt MarshMADVIRLAPDSFRTIYLRREDRVILLTETGRRIFIKRI
Ga0181572_1016567613300018049Salt MarshMAVDDIILAPESFQTIYLRREDRVILRTERGEKIIIKRIIPEEWQPYRYFDYEFALNEKKKEI
Ga0181572_1054967713300018049Salt MarshMAVEDIILTPESFETIYLRREDRVILRTEKGAKIIIKRIIPDEWVAYRYYEYEEDINNNKKEIL
Ga0181561_1055022223300018410Salt MarshMAVDLVKLTPESFETIYLRKEDRVIIRTEQGRKIIIKR
Ga0181592_1071875233300018421Salt MarshMADVIRLAPDSFRTIYLRREDRVILLTETGRRIFIKRIIPDEWVPYRIYEQEEALNDN
Ga0181591_1114924513300018424Salt MarshMAVDQVILAPESFRTIYLRKEDRVILRTEQGRKIIIKRIIPDEWKE
Ga0194024_116093423300019765FreshwaterMAINQFILSPESFRTIYLRKEDRVILRTEKGERIIIRRIIPD
Ga0181575_1049977413300020055Salt MarshMSVDDIILAPESFQTIYLRREDRVILRTERGEKIIIKRI
Ga0181573_1023073913300020184Salt MarshMADVIRLAPDSFRTIYLRREDRVILLTETGRRIFIKRIIPDEWVPYRIYEQEEALNDNKKEIFLFDRK
Ga0181573_1044003413300020184Salt MarshMAVDDIILAPESFQTIYLRREDRVILRTERGEKIIIKRIIPEEWQPYRYFDYEFALNEKKKEIFLI
Ga0181578_1014174333300020189Salt MarshMAVDDILLAPESFQTIYLRREDRVILRTERGEKIIIKRIIPEEWVPYRIYDYELALN
Ga0181604_1028273613300020191Salt MarshMAVDQVILAPESFRTIYLRREDRVILLTEQGRKIIIKRIIPEE
Ga0181570_1031534913300020207Salt MarshMAVDDILLAPESFQTIYLRREDRVILRTERGEKIIIKRII
Ga0206682_1010723913300021185SeawaterMAVDQVILAPESFRTIYLRKEDRVILRTERGRKIII
Ga0206682_1017151633300021185SeawaterMAVDIIKLAPESFQTIYLRKEDRVILRTEQGRKIIIKR
Ga0213867_102225813300021335SeawaterMAVDQVILAPESFRTIYLRKEDRVILRTEQGRKIIIKRIIPDEWKEYRIYEYEKDRNEAKKDI
Ga0210307_102186133300021336EstuarineMAVDIIKLAPESFQTIYLRKEDRIILRTEQGRKIIIK
Ga0213859_1021405413300021364SeawaterMAVEQVKLTADSFRTIYLRREDRVILRTETGVKIIIRRIIPDEWRPWRVYENEEALNDN
Ga0213860_1015130413300021368SeawaterMAELIRLAPDSFRTIYLRREDRVILLTEYGRKIIIKRIIPEEWKPWRVYEDEEAKNDN
Ga0213865_1026790213300021373SeawaterMAVDQVILAPESFRTIYLRKEDRVILRTEQGRKIIIKRIIPDEWSAYRIFEYEKDRNE
Ga0213866_1056868023300021425SeawaterMAVDEIILAPESFQTIYLRREDRVILRTEQGRKIIIKRIVPEEWKPYRIYDYERDLNENKKE
Ga0212030_102925133300022053AqueousMAVDNIILAPESFRTIYLRKEDRVIMRTERGDKIIIK
Ga0212021_106968813300022068AqueousMALEQLILSPDSFQTIYLRKEDRVIIRTEKGEKIIIKRIIPD
Ga0196905_112071813300022198AqueousMAVDEIILAPESFRTIYLRREDRVILRTENGRKIIVKRIIPEEWEPYR
Ga0222646_10184283300022822Saline WaterMAVDIIKLSPESFETIYLRKEDRVILRTEQGRKIIIRRIIPEEWK
Ga0255771_102088593300022900Salt MarshMAVEDIILTPESFETIYLRREDRVILRTEKGAKIIIK
Ga0255781_1000061013300022934Salt MarshMAVDEIILAPESFQTIYLRREDRVILRTEQGRKIII
Ga0255770_1049157813300022937Salt MarshMADVIRLAPDSFRTIYLRREDRVILLTETGRRIFIK
Ga0255754_1006460013300022939Salt MarshMAVDDILLAPESFQTIYLRREDRVILRTERGEKIIIK
Ga0228682_102403113300023698SeawaterMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPSEWKP
(restricted) Ga0233438_1006320313300024255SeawaterMAVEIVKLAPESFRTIYLRKEDRVILRTETGRKIIIKRIIPDEWK
(restricted) Ga0233438_1039519213300024255SeawaterMAVDIIKLTPDSFLTIYLRREDRVILRTEQGRKIVIKRIIPAEWKAWRIYDNENAINENKREI
(restricted) Ga0233439_1010000313300024261SeawaterMAVDEILLAPESFQTIYLRREDRVILRTEQGRKIIIKRIIPEEWEPYRIYQYEQDLNDNKKEIYLFDKN
(restricted) Ga0233439_1037547713300024261SeawaterMAVDQVILAPESFRTIYLRREDRVILLTEQGRKIIIK
Ga0228610_102048843300024281SeawaterMAVDIVKLAPESFQTIYLRKEDRIVLRTEQGRKIIIKRIIPNELKPWKIYD
Ga0228664_110005813300024294SeawaterMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPDEWK
Ga0233398_107954533300024320SeawaterMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRII
Ga0228631_104052913300024329SeawaterMAVDIIKLAPESFQTIYLRKEDRVILRTEQGRKIIIKRIIPD
Ga0228659_103420833300024332SeawaterMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPSEWKPWRVYDQELADNNNK
Ga0244776_1016743513300024348EstuarineMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPDEWKPWRVYDQELADNNNKKEIFL
Ga0244776_1059943213300024348EstuarineMAVDQVILAPESFRTIYLRKEDRVILRTERGRKIIIKRIIPDEWKEYRIYDFERDRNESK
Ga0233393_110986523300024413SeawaterMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPSEWKPWRVYDQELADNNNKKEIFLVD
Ga0209138_112746233300025617MarineMAVDNIILAPESFRTIYLRKEDRVIMRTERGQKIIIKRIIPEDWVPYRIFEYEEQIN
Ga0209659_122929023300025658MarineMAAVDEILLAPESFRTIYLRREDRVIMRTEQGQKIIIRRIIPEEWKPYRIYDYEQT
Ga0208162_118127223300025674AqueousMAAVDEILLAPESFRTIYLRREDRVIMRTEQGAKIIIKRIIPEE
Ga0209771_120464223300025701MarineMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPNEWKPWRVYDQELADNNNKKEIFLVD
Ga0208427_115708313300025771AqueousMAVDLIKLSPDSFRTIFLRKEDRTILRTEAGRRIVIKRIIPEEWQAYRVYEY
Ga0209534_1044795213300025880Pelagic MarineMAVDNIILAPESFRTIYLRREDRVIMRTERGQKIIVKRIVPEDWVPYRVFDHETQLNDNKKEIF
Ga0209309_1033994733300025881Pelagic MarineMAIEQFVLSPESFRTIYLRKEDRVILRTERGAKIIIRR
Ga0209630_1035434623300025892Pelagic MarineMAVDNIVLAPESFRTIYLRREDRVILRTERGQKIIVKRIIPDDWVPYRIFEYETQINDNKKEI
Ga0247578_111301523300026458SeawaterMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPSEWKPWRVYDQEL
Ga0247605_102186233300026503SeawaterMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIK
Ga0208921_102581113300027188EstuarineMAAVDDIILAPESFRTIYLRREDRVILRTEQGRKIIVKRIIPEEWQPYRM
Ga0208927_106570633300027220EstuarineMAAVDEILLAPESFRTIYLRREDRVIMRTELGQKIIIKRIIPEEWEPYRIF
Ga0208172_105016133300027231EstuarineMAAVDEILLAPESFRTIYLRREDRVIMRTELGQKIIIKRIIPEE
Ga0208678_109256923300027233EstuarineMAVDIIKLAPESFQTIYLRKEDRVILRTEQGRKIIIKRIIPDEWKEWKIFDQ
Ga0208897_116230723300027571EstuarineMAVNDIILAPESFRTIYLRREDRVILRTERGQKIIVKRIIPD
Ga0208304_1026086823300027751EstuarineMAVDNIILAPESFRTIYLRKEDRVIMRTERGQKIIIKRIIPEDWVPYRIFEYEEQINDNKKE
Ga0209192_1001777863300027752MarineMAVDDIILAPESFRTIYLRREDRVIMRTERGQKIIVKRIIPEDWLPYRIFEHETTLNDNKKEIFL
Ga0209502_1034096233300027780MarineMAVDNLILAPESFRTIYLRKEDRVIMRTERGQKIIIKRIIPEDWVPYRIFEY
Ga0228674_120577423300028008SeawaterMAVDIVKLAPESFQTIYLRKEDRIVLRTEQGRKIIIKRIIPNEWKPWKIYDDEEAKN
Ga0228634_101770613300028129SeawaterMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPDEW
Ga0247601_102872623300028330SeawaterMAVDIVKLAPESFRTIYLRKEDRIILRTEQGRKIIIKRIIPSEWKPWRVYDQELADNNNKKRNLFGG
Ga0302126_1013053533300031622MarineMAVDSIILAPESFRTIYLRREDRVIMRTERGQKIIIK
Ga0307997_1029320413300031706MarineMAVDIIKLAPESFQTIYLRKEDRIVLRTEQGRKIIIKRIIPSEWKEWKVYD
Ga0315320_1089689813300031851SeawaterMAVDEIILAPESFRTIYLRREDRVILRTELGRKIIVKRLIPEEWEPYRIYDF
Ga0315321_1071000923300032088SeawaterMAVDIIKLAPESFQTIYLRKEDRVILRTEQGRKIIIKRIIPDEWKEWKI
Ga0316204_1067319713300032373Microbial MatMAVDLIKLTPDSFLTIYLRREDRVILRTEQGRKIVIKRIIPEEWKAWRIYDNENAINENKREI
Ga0334982_0449980_1_1713300033981FreshwaterMAVDFIRLAPDSFRTIFLRKEDRVILRTEAGRRIVIKRIIPAEWVPYRVYEYEQALN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.