Basic Information | |
---|---|
Taxon OID | 3300001760 Open in IMG/M |
Scaffold ID | CSTRM40_1007120 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from Belvaux, Luxembourg - M40 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1591 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Belvaux, Luxembourg | |||||||
Coordinates | Lat. (o) | 49.506095 | Long. (o) | 5.943536 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043669 | Metagenome / Metatranscriptome | 156 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
CSTRM40_10071202 | F043669 | N/A | MDKLALQSLISKMSIATGEEYHLTESDKLAILSAFHKCEKWLIALQGEGVISVSEQDLEYLRDLADNVEGDINGKWSLDKPEYLAILITLQDYLNDIPCN* |
⦗Top⦘ |