Basic Information | |
---|---|
Taxon OID | 3300001760 Open in IMG/M |
Scaffold ID | CSTRM40_1000994 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from Belvaux, Luxembourg - M40 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7447 |
Total Scaffold Genes | 14 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 13 (92.86%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Belvaux, Luxembourg | |||||||
Coordinates | Lat. (o) | 49.506095 | Long. (o) | 5.943536 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F037272 | Metagenome / Metatranscriptome | 168 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
CSTRM40_10009942 | F037272 | GAGG | MTGKQIMRIHTANGVEEIDADRLIVEGDEYVLFQGEEEVRRVPIADILSETDPETGEEAGGIETIYSRS* |
⦗Top⦘ |