Basic Information | |
---|---|
Taxon OID | 3300001676 Open in IMG/M |
Scaffold ID | TuiMalila_1004453 Open in IMG/M |
Source Dataset Name | Black smokers hydrothermal plume microbial communities from Tui Malila, Lau Basin, Pacific Ocean |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4398 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Tui Malila, Lau Basin, Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Tui Malila, Lau Basin, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -21.99002 | Long. (o) | -176.568744 | Alt. (m) | Depth (m) | 2000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F080654 | Metagenome / Metatranscriptome | 115 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
TuiMalila_10044534 | F080654 | GAG | VVAEVISEETAESEPVGKTDLEERQNLWNKIQKFDPEASAMDYYDNNEWDLEKMRSDLKVLLEKEKFGR* |
⦗Top⦘ |