NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold OAud_106139

Scaffold OAud_106139


Overview

Basic Information
Taxon OID3300001667 Open in IMG/M
Scaffold IDOAud_106139 Open in IMG/M
Source Dataset NamebarOA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)529
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Cold Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Basin, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Santa Barbara Basin
CoordinatesLat. (o)13.2648Long. (o)-59.4253Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016971Metagenome / Metatranscriptome243Y

Sequences

Protein IDFamilyRBSSequence
OAud_1061391F016971AGGAGGMKQVAQHLPNEEKCAVEIVVHVSKNLGDEQQNQVVSALKETDGIIGAEFCLMRNHLVLAKYDRGSMSSQDVLKSFNSLNLDARLIGPI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.