| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001667 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0096604 | Gp0055468 | Ga0013014 |
| Sample Name | barOA |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 11034474 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From The Santa Barbara Basin, California, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Cold Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Basin, California, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine cold seep biome → cold seep → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: California: Santa Barbara Basin | |||||||
| Coordinates | Lat. (o) | 13.2648 | Long. (o) | -59.4253 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016971 | Metagenome / Metatranscriptome | 243 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| OAud_106139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 529 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| OAud_106139 | OAud_1061391 | F016971 | MKQVAQHLPNEEKCAVEIVVHVSKNLGDEQQNQVVSALKETDGIIGAEFCLMRNHLVLAKYDRGSMSSQDVLKSFNSLNLDARLIGPI* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |