NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_1016411

Scaffold Draft_1016411


Overview

Basic Information
Taxon OID3300001197 Open in IMG/M
Scaffold IDDraft_1016411 Open in IMG/M
Source Dataset NameWastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Sediment core from a heavy oil reservoir,Alberta Canada Inniskillen 614.3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2711
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameAlberta, Canada
CoordinatesLat. (o)56.04Long. (o)-118.13Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087872Metagenome110N

Sequences

Protein IDFamilyRBSSequence
Draft_10164113F087872N/AMRQAIYILLFLVASAGYSQESNYPEVANVLVEEFYTDAAKENFYPRQYVEKNLKGIYFVSARTIEKYVGRNDNRAATLAHSYNDLTGKTEVLILVDKSRIDNLPNIKVFLYHELGHFLGSSHEESISPDIMNSEINSTFLTEETLRYYFQKLKNIAPIKYRQQQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.