NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001197

3300001197: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Sediment core from a heavy oil reservoir,Alberta Canada Inniskillen 614.3



Overview

Basic Information
IMG/M Taxon OID3300001197 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0047444 | Gp0055907 | Ga0012413
Sample NameWastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Sediment core from a heavy oil reservoir,Alberta Canada Inniskillen 614.3
Sequencing StatusPermanent Draft
Sequencing CenterMcGill University
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size89229498
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Sanguibacteroides → Sanguibacteroides justesenii1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHydrocarbon Resource Environments Microbial Communities From Canada And Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeoil reservoirsediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationAlberta, Canada
CoordinatesLat. (o)56.04Long. (o)-118.13Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077438Metagenome / Metatranscriptome117Y
F087872Metagenome110N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Draft_1001839All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Sanguibacteroides → Sanguibacteroides justesenii1717Open in IMG/M
Draft_1016411All Organisms → cellular organisms → Bacteria2711Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Draft_1001839Draft_10018394F077438STHRVEPSFIQSSFEKHFLWNLQVEISSDLTPILDMEISSY*
Draft_1016411Draft_10164113F087872MRQAIYILLFLVASAGYSQESNYPEVANVLVEEFYTDAAKENFYPRQYVEKNLKGIYFVSARTIEKYVGRNDNRAATLAHSYNDLTGKTEVLILVDKSRIDNLPNIKVFLYHELGHFLGSSHEESISPDIMNSEINSTFLTEETLRYYFQKLKNIAPIKYRQQQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.