NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12419J13241_1000197

Scaffold JGI12419J13241_1000197


Overview

Basic Information
Taxon OID3300001077 Open in IMG/M
Scaffold IDJGI12419J13241_1000197 Open in IMG/M
Source Dataset NameCellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - BGW Initial Compost
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17824
Total Scaffold Genes37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)35 (94.59%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Varidnaviria → Bamfordvirae → Preplasmiviricota → Tectiliviricetes → Kalamavirales → Tectiviridae → Deltatectivirus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Comparative Metagneomics Of Mesophilic And Thermophilic Cellulose-Adapted Consortia

Source Dataset Sampling Location
Location NameBerkeley, CA
CoordinatesLat. (o)37.86971Long. (o)-122.31414Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024195Metagenome / Metatranscriptome207Y

Sequences

Protein IDFamilyRBSSequence
JGI12419J13241_100019723F024195AGGAGGMGDKVFNVLGAIVTVALVTTIVSRPTSAQVIKSMGDAFAGSIRAALGK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.