Basic Information | |
---|---|
Taxon OID | 3300000477 Open in IMG/M |
Scaffold ID | SL_5KL_010_SEDDRAFT_10000930 Open in IMG/M |
Source Dataset Name | Alkaline sediment microbial communities from Lake Bitter, Kulunda Steppe, Russia - 5KL_010_SED |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 18339 |
Total Scaffold Genes | 17 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (82.35%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Russia: Kulunda Steppe, Lake Bitter | |||||||
Coordinates | Lat. (o) | 51.4 | Long. (o) | 79.54 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011425 | Metagenome | 291 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SL_5KL_010_SEDDRAFT_1000093017 | F011425 | GGAG | MPDRRHFLSTLAGASLAGAAGLVRPPSLSAAPTAWL |
⦗Top⦘ |