Basic Information | |
---|---|
Taxon OID | 3300000270 Open in IMG/M |
Scaffold ID | HuiMet_106990 Open in IMG/M |
Source Dataset Name | Marine microbial mat from the Comau fjord, Huinay, Chile. Sample sequenced in March 2012 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | OMICS Solution |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1105 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Microbialites → Marine → Marine Microbial Communities From The Comau Fjord, Huinay, Region De Los Lagos, Chile |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Chile: Los Lagos Region | |||||||
Coordinates | Lat. (o) | -42.021639 | Long. (o) | -72.689161 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001728 | Metagenome / Metatranscriptome | 645 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
HuiMet_1069902 | F001728 | N/A | MNSVELIEVSKDYYRLMLNGVDVTGVQERSVFRHLLEVVDNKISN* |
⦗Top⦘ |