| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000270 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0070034 | Gp0054117 | Ga0011190 |
| Sample Name | Marine microbial mat from the Comau fjord, Huinay, Chile. Sample sequenced in March 2012 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | OMICS Solution |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 21715148 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Predicted Viral | 2 |
| All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From The Comau Fjord, Huinay, Region De Los Lagos, Chile |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Intertidal Zone → Microbialites → Marine → Marine Microbial Communities From The Comau Fjord, Huinay, Region De Los Lagos, Chile |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → fjord → rock |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Chile: Los Lagos Region | |||||||
| Coordinates | Lat. (o) | -42.021639 | Long. (o) | -72.689161 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001728 | Metagenome / Metatranscriptome | 645 | Y |
| F006002 | Metagenome / Metatranscriptome | 384 | Y |
| F067737 | Metagenome / Metatranscriptome | 125 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| HuiMet_100465 | All Organisms → Viruses → Predicted Viral | 4281 | Open in IMG/M |
| HuiMet_102864 | All Organisms → Viruses → Predicted Viral | 1814 | Open in IMG/M |
| HuiMet_106990 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | 1105 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| HuiMet_100465 | HuiMet_1004654 | F006002 | MRAKYCKCKNTYSIKCDKYSKRKKCNDDEYWKQGIGSIRKTTEE* |
| HuiMet_102864 | HuiMet_1028642 | F067737 | MENTNLKLALREVGKLIRGNLKEGAKNDGFKASGKLDKSFKYRVEDNELYIFGEEYANALSKGIDKKGRYSKEMSSNLVKWAKIKGLRPQFRDKKGRFTKVTDRTWKSLGFVLARSIAGKSNARNPKNPKGGISERFGYKGSGFIKAVQEQTRTQIKNIITEAYKKDIEEQLNSITALK* |
| HuiMet_106990 | HuiMet_1069902 | F001728 | MNSVELIEVSKDYYRLMLNGVDVTGVQERSVFRHLLEVVDNKISN* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |