NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold HuiMet_100465

Scaffold HuiMet_100465


Overview

Basic Information
Taxon OID3300000270 Open in IMG/M
Scaffold IDHuiMet_100465 Open in IMG/M
Source Dataset NameMarine microbial mat from the Comau fjord, Huinay, Chile. Sample sequenced in March 2012
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOMICS Solution
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4281
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Microbialites → Marine → Marine Microbial Communities From The Comau Fjord, Huinay, Region De Los Lagos, Chile

Source Dataset Sampling Location
Location NameChile: Los Lagos Region
CoordinatesLat. (o)-42.021639Long. (o)-72.689161Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006002Metagenome / Metatranscriptome384Y

Sequences

Protein IDFamilyRBSSequence
HuiMet_1004654F006002N/AMRAKYCKCKNTYSIKCDKYSKRKKCNDDEYWKQGIGSIRKTTEE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.