NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SI54feb11_200mDRAFT_c1030757

Scaffold SI54feb11_200mDRAFT_c1030757


Overview

Basic Information
Taxon OID3300000214 Open in IMG/M
Scaffold IDSI54feb11_200mDRAFT_c1030757 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 200m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)584
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet 54, Vancouver Island, BC, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042172Metagenome158Y

Sequences

Protein IDFamilyRBSSequence
SI54feb11_200mDRAFT_10307571F042172N/AKRDFLNKKIPLIVIKNIGSELKGASPEIILEKIILNVDDDLEDIFDFTTLKTDIKKNINRLLDKLSGEKKDNSGKEKIDHQKVINNLKDLF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.