| Basic Information | |
|---|---|
| Taxon OID | 2263196002 Open in IMG/M |
| Scaffold ID | LD2009400mD_c02782 Open in IMG/M |
| Source Dataset Name | April 2009 400 m contigs |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Royal Institute of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1291 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine (Brackish) → Marine Microbial Communities From Depth Transect At Landsort Deep In The Baltic Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Landsort Deep, Baltic Sea | |||||||
| Coordinates | Lat. (o) | 58.583333 | Long. (o) | 18.233333 | Alt. (m) | Depth (m) | 400 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025141 | Metagenome / Metatranscriptome | 203 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LD2009400mD_027822 | F025141 | N/A | MIQCEYCPRGFIETVNGLAEKTFHELLHEPTVVNK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |