| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2263196002 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0051352 | Gp0053582 | Ga0011274 |
| Sample Name | April 2009 400 m contigs |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Royal Institute of Technology |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 7008531 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Depth Transect At Landsort Deep In The Baltic Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine (Brackish) → Marine Microbial Communities From Depth Transect At Landsort Deep In The Baltic Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → intertidal zone → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Landsort Deep, Baltic Sea | |||||||
| Coordinates | Lat. (o) | 58.583333 | Long. (o) | 18.233333 | Alt. (m) | N/A | Depth (m) | 400 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025141 | Metagenome / Metatranscriptome | 203 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| LD2009400mD_c02782 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1291 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| LD2009400mD_c02782 | LD2009400mD_027822 | F025141 | MIQCEYCPRGFIETVNGLAEKTFHELLHEPTVVNK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |