NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2217009406

Scaffold 2217009406


Overview

Basic Information
Taxon OID2209111009 Open in IMG/M
Scaffold ID2217009406 Open in IMG/M
Source Dataset NameSaline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS19
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGATC-Biotech AG, Konstanz, Germany
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)552
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain

Source Dataset Sampling Location
Location NameSpain: Bras del Port
CoordinatesLat. (o)38.11Long. (o)-0.36Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003268Metagenome / Metatranscriptome496Y

Sequences

Protein IDFamilyRBSSequence
2217062681F003268AGGMSASIPNNLPGLEKLVRRIAQAEKSNQKDVRLTIQEARELSNELAILTANLGKTVGEIHAILKEIRDNTTNIDVKFDGGGF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.