Basic Information | |
---|---|
Taxon OID | 2189573000 Open in IMG/M |
Scaffold ID | GPBTN7E01C8WXR Open in IMG/M |
Source Dataset Name | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 540 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rothamsted, Harpenden, UK | |||||||
Coordinates | Lat. (o) | 51.804241 | Long. (o) | -0.372114 | Alt. (m) | Depth (m) | 0 to .21 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F079699 | Metagenome / Metatranscriptome | 115 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
N55_01489100 | F079699 | N/A | MKVFFKFVAGCAVKGGGPQRELDSPGNWFAPPGSNRSSGGGNEAAEAFGVEGRIGDSASMQAVT |
⦗Top⦘ |