Basic Information | |
---|---|
Taxon OID | 2170459001 Open in IMG/M |
Scaffold ID | W1_contig00594 Open in IMG/M |
Source Dataset Name | soil microbial communities from McMurdo Dry Valleys (Wright Valley), Antarctica |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New Mexico |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1619 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Polar Desert → Polar Desert Microbial Communities From Mcmurdo Dry Valleys, Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | McMurdo Dry Valleys (Wright Valley), Antarctica | |||||||
Coordinates | Lat. (o) | 77.4475 | Long. (o) | 162.676389 | Alt. (m) | Depth (m) | .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000584 | Metagenome / Metatranscriptome | 1007 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
W1_0594.00000010 | F000584 | N/A | MARKTHHKHSSTKGYRRLLDGLADLEGVHSVATGRVKPRMGSGRPVAPISKVRTTESGLSITINADGAIVDAYVVTDRPAEVAAAIAERGWSASS |
⦗Top⦘ |