NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GPICI_9042358

Scaffold GPICI_9042358


Overview

Basic Information
Taxon OID2088090015 Open in IMG/M
Scaffold IDGPICI_9042358 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa, Continuous Corn soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1789
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m).1016
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003001Metagenome / Metatranscriptome514Y
F018251Metagenome / Metatranscriptome236Y

Sequences

Protein IDFamilyRBSSequence
GPICI_01772160F018251N/AMRKTIILAIATAFLAGVSVVTGLARSAHGPVNDVTSTRPMVNPLTIGTLAAKVFPAT
GPICI_01772170F003001GGAGMIRTAIISVTASIVLIGAWTINLVSYHPTNDLNPLAPLNAPVDWK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.