Basic Information | |
---|---|
Family ID | F003001 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 514 |
Average Sequence Length | 44 residues |
Representative Sequence | MIRTAIISVTASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDWK |
Number of Associated Samples | 286 |
Number of Associated Scaffolds | 514 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 74.90 % |
% of genes near scaffold ends (potentially truncated) | 34.82 % |
% of genes from short scaffolds (< 2000 bps) | 84.24 % |
Associated GOLD sequencing projects | 260 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (60.700 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.980 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.817 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.603 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.36% β-sheet: 0.00% Coil/Unstructured: 61.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 514 Family Scaffolds |
---|---|---|
PF00027 | cNMP_binding | 3.89 |
PF13545 | HTH_Crp_2 | 2.92 |
PF00563 | EAL | 2.33 |
PF00111 | Fer2 | 2.14 |
PF06823 | DUF1236 | 1.56 |
PF00211 | Guanylate_cyc | 1.36 |
PF09361 | Phasin_2 | 1.17 |
PF04392 | ABC_sub_bind | 0.97 |
PF13361 | UvrD_C | 0.58 |
PF00990 | GGDEF | 0.58 |
PF04960 | Glutaminase | 0.39 |
PF13426 | PAS_9 | 0.39 |
PF00571 | CBS | 0.39 |
PF04134 | DCC1-like | 0.39 |
PF13305 | TetR_C_33 | 0.39 |
PF04226 | Transgly_assoc | 0.39 |
PF02586 | SRAP | 0.39 |
PF01068 | DNA_ligase_A_M | 0.39 |
PF01464 | SLT | 0.39 |
PF00188 | CAP | 0.19 |
PF05425 | CopD | 0.19 |
PF05532 | CsbD | 0.19 |
PF00196 | GerE | 0.19 |
PF01774 | UreD | 0.19 |
PF06904 | Extensin-like_C | 0.19 |
PF01979 | Amidohydro_1 | 0.19 |
PF00534 | Glycos_transf_1 | 0.19 |
PF00583 | Acetyltransf_1 | 0.19 |
PF01523 | PmbA_TldD | 0.19 |
PF00578 | AhpC-TSA | 0.19 |
PF01546 | Peptidase_M20 | 0.19 |
PF13579 | Glyco_trans_4_4 | 0.19 |
PF01522 | Polysacc_deac_1 | 0.19 |
PF05199 | GMC_oxred_C | 0.19 |
PF16884 | ADH_N_2 | 0.19 |
PF02195 | ParBc | 0.19 |
PF09913 | DUF2142 | 0.19 |
PF02798 | GST_N | 0.19 |
PF13467 | RHH_4 | 0.19 |
PF01135 | PCMT | 0.19 |
PF04909 | Amidohydro_2 | 0.19 |
PF04828 | GFA | 0.19 |
PF02321 | OEP | 0.19 |
PF13533 | Biotin_lipoyl_2 | 0.19 |
PF00574 | CLP_protease | 0.19 |
PF13683 | rve_3 | 0.19 |
PF04311 | DUF459 | 0.19 |
PF12974 | Phosphonate-bd | 0.19 |
PF03330 | DPBB_1 | 0.19 |
PF08734 | GYD | 0.19 |
PF01266 | DAO | 0.19 |
PF13437 | HlyD_3 | 0.19 |
PF00083 | Sugar_tr | 0.19 |
PF13433 | Peripla_BP_5 | 0.19 |
PF11953 | DUF3470 | 0.19 |
PF14224 | DUF4331 | 0.19 |
PF07366 | SnoaL | 0.19 |
PF03466 | LysR_substrate | 0.19 |
PF12244 | DUF3606 | 0.19 |
COG ID | Name | Functional Category | % Frequency in 514 Family Scaffolds |
---|---|---|---|
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 2.33 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 2.33 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 2.33 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 2.33 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.36 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.97 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.39 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.39 |
COG2066 | Glutaminase | Amino acid transport and metabolism [E] | 0.39 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.39 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.39 |
COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.39 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.39 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.39 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.19 |
COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 0.19 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.19 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.19 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.19 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.19 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.19 |
COG2845 | Peptidoglycan O-acetyltransferase, SGNH hydrolase family | Cell wall/membrane/envelope biogenesis [M] | 0.19 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.19 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.19 |
COG3921 | Uncharacterized conserved protein, contains Extensin-like_C domain | Function unknown [S] | 0.19 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.19 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.19 |
COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.19 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.19 |
COG0829 | Urease accessory protein UreH | Posttranslational modification, protein turnover, chaperones [O] | 0.19 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 60.70 % |
All Organisms | root | All Organisms | 39.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090015|GPICI_8762639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4308 | Open in IMG/M |
2088090015|GPICI_9042358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1789 | Open in IMG/M |
2166559005|cont_contig101826 | Not Available | 579 | Open in IMG/M |
2170459012|GOYVCMS01DIF0K | Not Available | 506 | Open in IMG/M |
2199352025|deepsgr_contig00626.452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12330 | Open in IMG/M |
2199352025|deepsgr__Contig_103494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3976 | Open in IMG/M |
2199352025|deepsgr__Contig_126276 | Not Available | 1272 | Open in IMG/M |
2228664021|ICCgaii200_c0863277 | Not Available | 923 | Open in IMG/M |
2228664021|ICCgaii200_c0869113 | Not Available | 542 | Open in IMG/M |
2228664022|INPgaii200_c1070950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 971 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100436219 | Not Available | 1114 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101568350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1544 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101568351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1720 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104298651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
3300000550|F24TB_10179701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3261 | Open in IMG/M |
3300000550|F24TB_11184037 | Not Available | 772 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1060764 | Not Available | 577 | Open in IMG/M |
3300000787|JGI11643J11755_11516386 | Not Available | 738 | Open in IMG/M |
3300000787|JGI11643J11755_11770915 | Not Available | 643 | Open in IMG/M |
3300000955|JGI1027J12803_100455820 | Not Available | 865 | Open in IMG/M |
3300000955|JGI1027J12803_101685193 | Not Available | 1050 | Open in IMG/M |
3300003995|Ga0055438_10163655 | Not Available | 664 | Open in IMG/M |
3300004009|Ga0055437_10149654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 723 | Open in IMG/M |
3300004024|Ga0055436_10030816 | Not Available | 1371 | Open in IMG/M |
3300004024|Ga0055436_10069901 | Not Available | 986 | Open in IMG/M |
3300004025|Ga0055433_10033267 | Not Available | 974 | Open in IMG/M |
3300004157|Ga0062590_100624283 | Not Available | 953 | Open in IMG/M |
3300004463|Ga0063356_105045534 | Not Available | 567 | Open in IMG/M |
3300004479|Ga0062595_100041434 | Not Available | 2016 | Open in IMG/M |
3300004479|Ga0062595_102206660 | Not Available | 539 | Open in IMG/M |
3300004633|Ga0066395_10260082 | Not Available | 934 | Open in IMG/M |
3300004633|Ga0066395_10366773 | Not Available | 804 | Open in IMG/M |
3300005093|Ga0062594_101072446 | Not Available | 784 | Open in IMG/M |
3300005093|Ga0062594_102537871 | Not Available | 564 | Open in IMG/M |
3300005164|Ga0066815_10009365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1180 | Open in IMG/M |
3300005165|Ga0066869_10096102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 587 | Open in IMG/M |
3300005183|Ga0068993_10119772 | Not Available | 862 | Open in IMG/M |
3300005183|Ga0068993_10191309 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300005204|Ga0068997_10008028 | Not Available | 1450 | Open in IMG/M |
3300005205|Ga0068999_10022865 | Not Available | 958 | Open in IMG/M |
3300005213|Ga0068998_10022202 | Not Available | 1073 | Open in IMG/M |
3300005218|Ga0068996_10030389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 947 | Open in IMG/M |
3300005289|Ga0065704_10567586 | Not Available | 615 | Open in IMG/M |
3300005294|Ga0065705_10316808 | Not Available | 1019 | Open in IMG/M |
3300005329|Ga0070683_100635374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
3300005330|Ga0070690_100231762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1299 | Open in IMG/M |
3300005332|Ga0066388_100000799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16087 | Open in IMG/M |
3300005332|Ga0066388_100702175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1618 | Open in IMG/M |
3300005332|Ga0066388_101051163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1371 | Open in IMG/M |
3300005332|Ga0066388_101117323 | Not Available | 1337 | Open in IMG/M |
3300005332|Ga0066388_101148347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1321 | Open in IMG/M |
3300005332|Ga0066388_101218660 | Not Available | 1289 | Open in IMG/M |
3300005332|Ga0066388_101239458 | Not Available | 1279 | Open in IMG/M |
3300005332|Ga0066388_102703143 | Not Available | 906 | Open in IMG/M |
3300005332|Ga0066388_105362678 | Not Available | 650 | Open in IMG/M |
3300005332|Ga0066388_105755372 | Not Available | 627 | Open in IMG/M |
3300005332|Ga0066388_106280094 | Not Available | 600 | Open in IMG/M |
3300005335|Ga0070666_10368697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1030 | Open in IMG/M |
3300005337|Ga0070682_100909733 | Not Available | 724 | Open in IMG/M |
3300005347|Ga0070668_100605869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 959 | Open in IMG/M |
3300005354|Ga0070675_101351734 | Not Available | 657 | Open in IMG/M |
3300005365|Ga0070688_100729972 | Not Available | 769 | Open in IMG/M |
3300005434|Ga0070709_10000219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 37061 | Open in IMG/M |
3300005434|Ga0070709_10034780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3058 | Open in IMG/M |
3300005434|Ga0070709_10325602 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300005434|Ga0070709_10924422 | Not Available | 691 | Open in IMG/M |
3300005435|Ga0070714_101007973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
3300005436|Ga0070713_100581500 | Not Available | 1063 | Open in IMG/M |
3300005436|Ga0070713_100851454 | Not Available | 875 | Open in IMG/M |
3300005436|Ga0070713_101333163 | Not Available | 696 | Open in IMG/M |
3300005437|Ga0070710_10012343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4240 | Open in IMG/M |
3300005439|Ga0070711_100191561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1572 | Open in IMG/M |
3300005439|Ga0070711_100893775 | Not Available | 758 | Open in IMG/M |
3300005445|Ga0070708_100157228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2117 | Open in IMG/M |
3300005445|Ga0070708_101852488 | Not Available | 560 | Open in IMG/M |
3300005457|Ga0070662_100691578 | Not Available | 862 | Open in IMG/M |
3300005457|Ga0070662_101575625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 567 | Open in IMG/M |
3300005466|Ga0070685_10139902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1522 | Open in IMG/M |
3300005530|Ga0070679_101075848 | Not Available | 749 | Open in IMG/M |
3300005547|Ga0070693_100048703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2415 | Open in IMG/M |
3300005547|Ga0070693_100570328 | Not Available | 813 | Open in IMG/M |
3300005564|Ga0070664_100304482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1441 | Open in IMG/M |
3300005564|Ga0070664_101593157 | Not Available | 618 | Open in IMG/M |
3300005615|Ga0070702_101896660 | Not Available | 500 | Open in IMG/M |
3300005618|Ga0068864_100035575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4240 | Open in IMG/M |
3300005713|Ga0066905_100011955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4192 | Open in IMG/M |
3300005713|Ga0066905_100023590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3337 | Open in IMG/M |
3300005713|Ga0066905_100061356 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
3300005713|Ga0066905_100241129 | Not Available | 1382 | Open in IMG/M |
3300005713|Ga0066905_100334623 | Not Available | 1203 | Open in IMG/M |
3300005713|Ga0066905_100586394 | Not Available | 941 | Open in IMG/M |
3300005713|Ga0066905_100659077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
3300005713|Ga0066905_100707317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
3300005713|Ga0066905_100742357 | Not Available | 846 | Open in IMG/M |
3300005713|Ga0066905_100745919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 844 | Open in IMG/M |
3300005713|Ga0066905_100778011 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300005713|Ga0066905_100999660 | Not Available | 737 | Open in IMG/M |
3300005713|Ga0066905_101006117 | Not Available | 735 | Open in IMG/M |
3300005713|Ga0066905_102304715 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300005764|Ga0066903_101123504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1451 | Open in IMG/M |
3300005764|Ga0066903_101135655 | Not Available | 1444 | Open in IMG/M |
3300005764|Ga0066903_101241307 | Not Available | 1387 | Open in IMG/M |
3300005764|Ga0066903_102492373 | Not Available | 1001 | Open in IMG/M |
3300005764|Ga0066903_106694501 | Not Available | 599 | Open in IMG/M |
3300005843|Ga0068860_100442081 | Not Available | 1292 | Open in IMG/M |
3300005843|Ga0068860_101395841 | Not Available | 722 | Open in IMG/M |
3300005844|Ga0068862_101456625 | Not Available | 689 | Open in IMG/M |
3300005937|Ga0081455_10079792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2686 | Open in IMG/M |
3300005937|Ga0081455_10192758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium delmotii | 1533 | Open in IMG/M |
3300005937|Ga0081455_10205616 | Not Available | 1471 | Open in IMG/M |
3300006028|Ga0070717_10253266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1556 | Open in IMG/M |
3300006041|Ga0075023_100056142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1249 | Open in IMG/M |
3300006041|Ga0075023_100174071 | Not Available | 811 | Open in IMG/M |
3300006041|Ga0075023_100312150 | Not Available | 652 | Open in IMG/M |
3300006047|Ga0075024_100052873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1701 | Open in IMG/M |
3300006047|Ga0075024_100235765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 872 | Open in IMG/M |
3300006047|Ga0075024_100469889 | Not Available | 654 | Open in IMG/M |
3300006049|Ga0075417_10058646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1680 | Open in IMG/M |
3300006049|Ga0075417_10076470 | Not Available | 1488 | Open in IMG/M |
3300006049|Ga0075417_10284928 | Not Available | 798 | Open in IMG/M |
3300006049|Ga0075417_10388721 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300006049|Ga0075417_10708424 | Not Available | 517 | Open in IMG/M |
3300006050|Ga0075028_100002735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6524 | Open in IMG/M |
3300006050|Ga0075028_100005241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5032 | Open in IMG/M |
3300006050|Ga0075028_100808577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 572 | Open in IMG/M |
3300006057|Ga0075026_100786003 | Not Available | 576 | Open in IMG/M |
3300006057|Ga0075026_100789001 | Not Available | 575 | Open in IMG/M |
3300006058|Ga0075432_10106320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1042 | Open in IMG/M |
3300006086|Ga0075019_10498681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
3300006102|Ga0075015_100587297 | Not Available | 651 | Open in IMG/M |
3300006172|Ga0075018_10750967 | Not Available | 531 | Open in IMG/M |
3300006173|Ga0070716_100404661 | Not Available | 982 | Open in IMG/M |
3300006173|Ga0070716_101058311 | Not Available | 645 | Open in IMG/M |
3300006196|Ga0075422_10000363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 11612 | Open in IMG/M |
3300006196|Ga0075422_10130651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 988 | Open in IMG/M |
3300006196|Ga0075422_10512682 | Not Available | 545 | Open in IMG/M |
3300006806|Ga0079220_10567727 | Not Available | 796 | Open in IMG/M |
3300006806|Ga0079220_10770936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
3300006846|Ga0075430_100622303 | Not Available | 890 | Open in IMG/M |
3300006847|Ga0075431_101468777 | Not Available | 640 | Open in IMG/M |
3300006847|Ga0075431_102100655 | Not Available | 520 | Open in IMG/M |
3300006852|Ga0075433_10032736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4454 | Open in IMG/M |
3300006854|Ga0075425_100013276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8857 | Open in IMG/M |
3300006854|Ga0075425_100966398 | Not Available | 972 | Open in IMG/M |
3300006854|Ga0075425_101079294 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300006854|Ga0075425_101121315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 895 | Open in IMG/M |
3300006854|Ga0075425_103027539 | Not Available | 513 | Open in IMG/M |
3300006871|Ga0075434_100379426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1434 | Open in IMG/M |
3300006871|Ga0075434_100739880 | Not Available | 1000 | Open in IMG/M |
3300006871|Ga0075434_102600812 | Not Available | 507 | Open in IMG/M |
3300006880|Ga0075429_100144353 | Not Available | 2083 | Open in IMG/M |
3300006904|Ga0075424_101187141 | Not Available | 812 | Open in IMG/M |
3300006904|Ga0075424_101296385 | Not Available | 774 | Open in IMG/M |
3300006904|Ga0075424_102203837 | Not Available | 580 | Open in IMG/M |
3300006904|Ga0075424_102689476 | Not Available | 519 | Open in IMG/M |
3300006914|Ga0075436_100132722 | Not Available | 1747 | Open in IMG/M |
3300006914|Ga0075436_100370942 | Not Available | 1034 | Open in IMG/M |
3300006914|Ga0075436_100472756 | Not Available | 915 | Open in IMG/M |
3300006914|Ga0075436_100790152 | Not Available | 706 | Open in IMG/M |
3300006954|Ga0079219_11945889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 557 | Open in IMG/M |
3300006969|Ga0075419_10467237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 873 | Open in IMG/M |
3300006969|Ga0075419_11061125 | Not Available | 592 | Open in IMG/M |
3300007076|Ga0075435_100028447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4384 | Open in IMG/M |
3300007076|Ga0075435_100215487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1629 | Open in IMG/M |
3300007076|Ga0075435_101594965 | Not Available | 572 | Open in IMG/M |
3300009053|Ga0105095_10144835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9 | 1295 | Open in IMG/M |
3300009092|Ga0105250_10110690 | Not Available | 1124 | Open in IMG/M |
3300009094|Ga0111539_13082718 | Not Available | 538 | Open in IMG/M |
3300009100|Ga0075418_10197380 | Not Available | 2143 | Open in IMG/M |
3300009100|Ga0075418_10790941 | Not Available | 1024 | Open in IMG/M |
3300009137|Ga0066709_101462270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 989 | Open in IMG/M |
3300009147|Ga0114129_10603963 | Not Available | 1421 | Open in IMG/M |
3300009147|Ga0114129_11396818 | Not Available | 864 | Open in IMG/M |
3300009147|Ga0114129_12574028 | Not Available | 607 | Open in IMG/M |
3300009147|Ga0114129_13351355 | Not Available | 517 | Open in IMG/M |
3300009162|Ga0075423_10027724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 5696 | Open in IMG/M |
3300009162|Ga0075423_10147117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2473 | Open in IMG/M |
3300009162|Ga0075423_10296112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1696 | Open in IMG/M |
3300009162|Ga0075423_10496535 | Not Available | 1283 | Open in IMG/M |
3300009168|Ga0105104_10077413 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
3300009168|Ga0105104_10217838 | Not Available | 1039 | Open in IMG/M |
3300009551|Ga0105238_10365337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1433 | Open in IMG/M |
3300009551|Ga0105238_10738522 | Not Available | 998 | Open in IMG/M |
3300009792|Ga0126374_11066298 | Not Available | 638 | Open in IMG/M |
3300009792|Ga0126374_11400683 | Not Available | 569 | Open in IMG/M |
3300010043|Ga0126380_10657752 | Not Available | 835 | Open in IMG/M |
3300010043|Ga0126380_10924058 | Not Available | 727 | Open in IMG/M |
3300010046|Ga0126384_10603364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 961 | Open in IMG/M |
3300010046|Ga0126384_11159613 | Not Available | 711 | Open in IMG/M |
3300010046|Ga0126384_11369992 | Not Available | 658 | Open in IMG/M |
3300010046|Ga0126384_12033615 | Not Available | 550 | Open in IMG/M |
3300010046|Ga0126384_12362714 | Not Available | 514 | Open in IMG/M |
3300010047|Ga0126382_10066922 | Not Available | 2183 | Open in IMG/M |
3300010047|Ga0126382_10232293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1338 | Open in IMG/M |
3300010047|Ga0126382_10955118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 747 | Open in IMG/M |
3300010047|Ga0126382_11485343 | Not Available | 622 | Open in IMG/M |
3300010047|Ga0126382_12299981 | Not Available | 521 | Open in IMG/M |
3300010154|Ga0127503_10215349 | Not Available | 508 | Open in IMG/M |
3300010154|Ga0127503_10583466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 632 | Open in IMG/M |
3300010359|Ga0126376_10052025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2902 | Open in IMG/M |
3300010359|Ga0126376_10857120 | Not Available | 893 | Open in IMG/M |
3300010359|Ga0126376_11909098 | Not Available | 634 | Open in IMG/M |
3300010360|Ga0126372_12008625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
3300010360|Ga0126372_12563750 | Not Available | 561 | Open in IMG/M |
3300010361|Ga0126378_10273173 | Not Available | 1788 | Open in IMG/M |
3300010362|Ga0126377_10364130 | Not Available | 1446 | Open in IMG/M |
3300010362|Ga0126377_10669343 | Not Available | 1088 | Open in IMG/M |
3300010362|Ga0126377_12221146 | Not Available | 625 | Open in IMG/M |
3300010362|Ga0126377_12985495 | Not Available | 546 | Open in IMG/M |
3300010366|Ga0126379_11750742 | Not Available | 726 | Open in IMG/M |
3300010371|Ga0134125_11113994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 864 | Open in IMG/M |
3300010373|Ga0134128_12675409 | Not Available | 550 | Open in IMG/M |
3300010373|Ga0134128_12955007 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 523 | Open in IMG/M |
3300010376|Ga0126381_101348968 | Not Available | 1031 | Open in IMG/M |
3300010376|Ga0126381_103650350 | Not Available | 603 | Open in IMG/M |
3300010398|Ga0126383_10038776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3866 | Open in IMG/M |
3300010398|Ga0126383_10075906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2913 | Open in IMG/M |
3300010400|Ga0134122_10014776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5823 | Open in IMG/M |
3300010401|Ga0134121_10361961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1301 | Open in IMG/M |
3300010401|Ga0134121_12092842 | Not Available | 600 | Open in IMG/M |
3300010401|Ga0134121_12492292 | Not Available | 559 | Open in IMG/M |
3300010403|Ga0134123_11335506 | Not Available | 754 | Open in IMG/M |
3300010863|Ga0124850_1053972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1254 | Open in IMG/M |
3300011000|Ga0138513_100013833 | Not Available | 1046 | Open in IMG/M |
3300011270|Ga0137391_10733007 | Not Available | 819 | Open in IMG/M |
3300012208|Ga0137376_10849780 | Not Available | 785 | Open in IMG/M |
3300012492|Ga0157335_1030465 | Not Available | 563 | Open in IMG/M |
3300012493|Ga0157355_1045573 | Not Available | 505 | Open in IMG/M |
3300012495|Ga0157323_1021296 | Not Available | 620 | Open in IMG/M |
3300012497|Ga0157319_1006530 | Not Available | 840 | Open in IMG/M |
3300012498|Ga0157345_1061208 | Not Available | 501 | Open in IMG/M |
3300012499|Ga0157350_1021213 | Not Available | 653 | Open in IMG/M |
3300012505|Ga0157339_1001352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1482 | Open in IMG/M |
3300012505|Ga0157339_1037865 | Not Available | 593 | Open in IMG/M |
3300012513|Ga0157326_1015054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 905 | Open in IMG/M |
3300012931|Ga0153915_10481270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9 | 1417 | Open in IMG/M |
3300012937|Ga0162653_100073333 | Not Available | 554 | Open in IMG/M |
3300012938|Ga0162651_100026477 | Not Available | 827 | Open in IMG/M |
3300012948|Ga0126375_10488400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
3300012948|Ga0126375_11121550 | Not Available | 649 | Open in IMG/M |
3300012948|Ga0126375_11195266 | Not Available | 632 | Open in IMG/M |
3300012951|Ga0164300_10020512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2280 | Open in IMG/M |
3300012951|Ga0164300_10390042 | Not Available | 762 | Open in IMG/M |
3300012957|Ga0164303_10160025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1203 | Open in IMG/M |
3300012958|Ga0164299_10039265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2129 | Open in IMG/M |
3300012958|Ga0164299_11578238 | Not Available | 516 | Open in IMG/M |
3300012960|Ga0164301_10418404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 943 | Open in IMG/M |
3300012960|Ga0164301_10599786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 813 | Open in IMG/M |
3300012961|Ga0164302_11014790 | Not Available | 648 | Open in IMG/M |
3300012961|Ga0164302_11086944 | Not Available | 630 | Open in IMG/M |
3300012971|Ga0126369_10759373 | Not Available | 1050 | Open in IMG/M |
3300012971|Ga0126369_11434092 | Not Available | 780 | Open in IMG/M |
3300012984|Ga0164309_10781249 | Not Available | 767 | Open in IMG/M |
3300012984|Ga0164309_11305758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 614 | Open in IMG/M |
3300012984|Ga0164309_11840784 | Not Available | 519 | Open in IMG/M |
3300012986|Ga0164304_10003087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6295 | Open in IMG/M |
3300012986|Ga0164304_10080493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1882 | Open in IMG/M |
3300012986|Ga0164304_11162171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
3300012987|Ga0164307_10709052 | Not Available | 789 | Open in IMG/M |
3300012988|Ga0164306_10310691 | Not Available | 1154 | Open in IMG/M |
3300013296|Ga0157374_11131425 | Not Available | 804 | Open in IMG/M |
3300013306|Ga0163162_10862170 | Not Available | 1020 | Open in IMG/M |
3300013306|Ga0163162_12047802 | Not Available | 656 | Open in IMG/M |
3300013306|Ga0163162_12525093 | Not Available | 591 | Open in IMG/M |
3300014308|Ga0075354_1049029 | Not Available | 773 | Open in IMG/M |
3300014308|Ga0075354_1068587 | Not Available | 688 | Open in IMG/M |
3300014318|Ga0075351_1009773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1344 | Open in IMG/M |
3300014321|Ga0075353_1041001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 930 | Open in IMG/M |
3300014321|Ga0075353_1121014 | Not Available | 633 | Open in IMG/M |
3300014325|Ga0163163_10475373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1310 | Open in IMG/M |
3300014968|Ga0157379_12308214 | Not Available | 536 | Open in IMG/M |
3300014968|Ga0157379_12413625 | Not Available | 525 | Open in IMG/M |
3300014969|Ga0157376_10251610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1650 | Open in IMG/M |
3300015371|Ga0132258_10208359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4747 | Open in IMG/M |
3300015371|Ga0132258_10495150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3055 | Open in IMG/M |
3300015371|Ga0132258_10804449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium → Roseibium album | 2370 | Open in IMG/M |
3300015371|Ga0132258_11207187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1912 | Open in IMG/M |
3300015371|Ga0132258_11952007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1477 | Open in IMG/M |
3300015371|Ga0132258_13746586 | Not Available | 1036 | Open in IMG/M |
3300015372|Ga0132256_100636017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. 1M-11 | 1182 | Open in IMG/M |
3300015372|Ga0132256_101419733 | Not Available | 806 | Open in IMG/M |
3300015372|Ga0132256_101459110 | Not Available | 795 | Open in IMG/M |
3300015372|Ga0132256_101479966 | Not Available | 790 | Open in IMG/M |
3300015372|Ga0132256_102490343 | Not Available | 619 | Open in IMG/M |
3300015374|Ga0132255_100043785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5776 | Open in IMG/M |
3300015374|Ga0132255_101407646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1054 | Open in IMG/M |
3300015374|Ga0132255_101610110 | Not Available | 984 | Open in IMG/M |
3300015374|Ga0132255_103257101 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300015374|Ga0132255_105671343 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300016294|Ga0182041_10000727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15923 | Open in IMG/M |
3300016371|Ga0182034_10533853 | Not Available | 983 | Open in IMG/M |
3300016387|Ga0182040_10891469 | Not Available | 737 | Open in IMG/M |
3300017939|Ga0187775_10063025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1165 | Open in IMG/M |
3300017944|Ga0187786_10010824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2226 | Open in IMG/M |
3300017944|Ga0187786_10482884 | Not Available | 558 | Open in IMG/M |
3300017947|Ga0187785_10001692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7475 | Open in IMG/M |
3300017947|Ga0187785_10001774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7263 | Open in IMG/M |
3300017947|Ga0187785_10200930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 868 | Open in IMG/M |
3300017947|Ga0187785_10244478 | Not Available | 801 | Open in IMG/M |
3300017947|Ga0187785_10286834 | Not Available | 752 | Open in IMG/M |
3300017959|Ga0187779_10006419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6843 | Open in IMG/M |
3300017959|Ga0187779_10203031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1241 | Open in IMG/M |
3300017961|Ga0187778_10026584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3534 | Open in IMG/M |
3300017965|Ga0190266_10508677 | Not Available | 704 | Open in IMG/M |
3300017966|Ga0187776_10008829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5373 | Open in IMG/M |
3300017966|Ga0187776_11084689 | Not Available | 594 | Open in IMG/M |
3300017974|Ga0187777_10002203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12509 | Open in IMG/M |
3300017974|Ga0187777_10039425 | Not Available | 3033 | Open in IMG/M |
3300017999|Ga0187767_10229845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
3300018000|Ga0184604_10117019 | Not Available | 845 | Open in IMG/M |
3300018027|Ga0184605_10449506 | Not Available | 568 | Open in IMG/M |
3300018028|Ga0184608_10031259 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
3300018028|Ga0184608_10256645 | Not Available | 769 | Open in IMG/M |
3300018028|Ga0184608_10286462 | Not Available | 724 | Open in IMG/M |
3300018029|Ga0187787_10010146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2341 | Open in IMG/M |
3300018032|Ga0187788_10549998 | Not Available | 505 | Open in IMG/M |
3300018051|Ga0184620_10250944 | Not Available | 594 | Open in IMG/M |
3300018053|Ga0184626_10418063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
3300018054|Ga0184621_10219898 | Not Available | 680 | Open in IMG/M |
3300018060|Ga0187765_10019453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3205 | Open in IMG/M |
3300018060|Ga0187765_10050141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2145 | Open in IMG/M |
3300018067|Ga0184611_1038990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1551 | Open in IMG/M |
3300018067|Ga0184611_1225548 | Not Available | 666 | Open in IMG/M |
3300018067|Ga0184611_1291343 | Not Available | 569 | Open in IMG/M |
3300018072|Ga0184635_10001950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6148 | Open in IMG/M |
3300018072|Ga0184635_10070522 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300018072|Ga0184635_10139860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 965 | Open in IMG/M |
3300018072|Ga0184635_10144402 | Not Available | 949 | Open in IMG/M |
3300018073|Ga0184624_10008537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3473 | Open in IMG/M |
3300018074|Ga0184640_10243100 | Not Available | 816 | Open in IMG/M |
3300018075|Ga0184632_10292417 | Not Available | 706 | Open in IMG/M |
3300018076|Ga0184609_10182556 | Not Available | 974 | Open in IMG/M |
3300018081|Ga0184625_10015738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3546 | Open in IMG/M |
3300018081|Ga0184625_10031788 | Not Available | 2586 | Open in IMG/M |
3300018081|Ga0184625_10261238 | Not Available | 906 | Open in IMG/M |
3300018081|Ga0184625_10375370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 737 | Open in IMG/M |
3300019869|Ga0193705_1088347 | Not Available | 586 | Open in IMG/M |
3300019873|Ga0193700_1034720 | Not Available | 825 | Open in IMG/M |
3300019877|Ga0193722_1115458 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300019879|Ga0193723_1012863 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
3300020002|Ga0193730_1120262 | Not Available | 720 | Open in IMG/M |
3300020006|Ga0193735_1175359 | Not Available | 533 | Open in IMG/M |
3300020015|Ga0193734_1058806 | Not Available | 695 | Open in IMG/M |
3300020018|Ga0193721_1094363 | Not Available | 770 | Open in IMG/M |
3300020018|Ga0193721_1105507 | Not Available | 719 | Open in IMG/M |
3300020080|Ga0206350_11049926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 563 | Open in IMG/M |
3300021078|Ga0210381_10238847 | Not Available | 643 | Open in IMG/M |
3300021078|Ga0210381_10297975 | Not Available | 582 | Open in IMG/M |
3300021478|Ga0210402_10853051 | Not Available | 837 | Open in IMG/M |
3300021560|Ga0126371_10001650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 18924 | Open in IMG/M |
3300021560|Ga0126371_10396859 | Not Available | 1520 | Open in IMG/M |
3300021560|Ga0126371_10631034 | Not Available | 1220 | Open in IMG/M |
3300021560|Ga0126371_11747804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 745 | Open in IMG/M |
3300022694|Ga0222623_10058737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 1483 | Open in IMG/M |
3300022756|Ga0222622_11064752 | Not Available | 595 | Open in IMG/M |
3300025321|Ga0207656_10384844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
3300025321|Ga0207656_10653615 | Not Available | 538 | Open in IMG/M |
3300025549|Ga0210094_1073399 | Not Available | 627 | Open in IMG/M |
3300025560|Ga0210108_1041803 | Not Available | 868 | Open in IMG/M |
3300025898|Ga0207692_10178429 | Not Available | 1236 | Open in IMG/M |
3300025905|Ga0207685_10776883 | Not Available | 526 | Open in IMG/M |
3300025906|Ga0207699_10430231 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300025915|Ga0207693_10325917 | Not Available | 1202 | Open in IMG/M |
3300025919|Ga0207657_10049799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 3648 | Open in IMG/M |
3300025921|Ga0207652_10950685 | Not Available | 757 | Open in IMG/M |
3300025925|Ga0207650_10138661 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
3300025926|Ga0207659_10362976 | Not Available | 1204 | Open in IMG/M |
3300025928|Ga0207700_10832038 | Not Available | 826 | Open in IMG/M |
3300025930|Ga0207701_10050622 | All Organisms → cellular organisms → Bacteria | 3821 | Open in IMG/M |
3300025932|Ga0207690_11126855 | Not Available | 654 | Open in IMG/M |
3300025932|Ga0207690_11357606 | Not Available | 594 | Open in IMG/M |
3300025933|Ga0207706_10009260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9048 | Open in IMG/M |
3300025936|Ga0207670_10764318 | Not Available | 803 | Open in IMG/M |
3300025937|Ga0207669_11023216 | Not Available | 695 | Open in IMG/M |
3300025937|Ga0207669_11026279 | Not Available | 694 | Open in IMG/M |
3300025940|Ga0207691_10481727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1054 | Open in IMG/M |
3300025942|Ga0207689_10076959 | Not Available | 2743 | Open in IMG/M |
3300025944|Ga0207661_11542534 | Not Available | 608 | Open in IMG/M |
3300025961|Ga0207712_10445582 | Not Available | 1097 | Open in IMG/M |
3300025979|Ga0210078_1012161 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300025979|Ga0210078_1019348 | Not Available | 879 | Open in IMG/M |
3300025979|Ga0210078_1029669 | Not Available | 728 | Open in IMG/M |
3300026023|Ga0207677_11636722 | Not Available | 596 | Open in IMG/M |
3300026023|Ga0207677_11904960 | Not Available | 552 | Open in IMG/M |
3300026089|Ga0207648_10046377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3810 | Open in IMG/M |
3300026089|Ga0207648_11029011 | Not Available | 772 | Open in IMG/M |
3300026362|Ga0256801_1000390 | Not Available | 1108 | Open in IMG/M |
3300026464|Ga0256814_1005620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1085 | Open in IMG/M |
3300027680|Ga0207826_1035977 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300027873|Ga0209814_10139540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1038 | Open in IMG/M |
3300027873|Ga0209814_10547084 | Not Available | 515 | Open in IMG/M |
3300027874|Ga0209465_10322923 | Not Available | 773 | Open in IMG/M |
3300027880|Ga0209481_10209359 | Not Available | 976 | Open in IMG/M |
3300027880|Ga0209481_10281660 | Not Available | 841 | Open in IMG/M |
3300027880|Ga0209481_10404011 | Not Available | 701 | Open in IMG/M |
3300027894|Ga0209068_10007021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5307 | Open in IMG/M |
3300027894|Ga0209068_10043879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2255 | Open in IMG/M |
3300027907|Ga0207428_10000058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 158579 | Open in IMG/M |
3300027907|Ga0207428_10003587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 14983 | Open in IMG/M |
3300027910|Ga0209583_10029951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1799 | Open in IMG/M |
3300027910|Ga0209583_10160072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 929 | Open in IMG/M |
3300027910|Ga0209583_10215138 | Not Available | 829 | Open in IMG/M |
3300027915|Ga0209069_10066129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1712 | Open in IMG/M |
3300027915|Ga0209069_10705350 | Not Available | 593 | Open in IMG/M |
3300028381|Ga0268264_10485115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1203 | Open in IMG/M |
3300028711|Ga0307293_10196491 | Not Available | 642 | Open in IMG/M |
3300028719|Ga0307301_10300276 | Not Available | 526 | Open in IMG/M |
3300028784|Ga0307282_10070005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1592 | Open in IMG/M |
3300028784|Ga0307282_10102303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1330 | Open in IMG/M |
3300028784|Ga0307282_10141684 | Not Available | 1135 | Open in IMG/M |
3300028784|Ga0307282_10661126 | Not Available | 506 | Open in IMG/M |
3300028787|Ga0307323_10204573 | Not Available | 713 | Open in IMG/M |
3300028791|Ga0307290_10348613 | Not Available | 542 | Open in IMG/M |
3300028792|Ga0307504_10143840 | Not Available | 803 | Open in IMG/M |
3300028793|Ga0307299_10234375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
3300028793|Ga0307299_10413929 | Not Available | 505 | Open in IMG/M |
3300028796|Ga0307287_10153260 | Not Available | 876 | Open in IMG/M |
3300028796|Ga0307287_10413424 | Not Available | 507 | Open in IMG/M |
3300028807|Ga0307305_10240741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 827 | Open in IMG/M |
3300028811|Ga0307292_10155365 | Not Available | 926 | Open in IMG/M |
3300028814|Ga0307302_10333541 | Not Available | 747 | Open in IMG/M |
3300028814|Ga0307302_10353266 | Not Available | 725 | Open in IMG/M |
3300028814|Ga0307302_10615129 | Not Available | 540 | Open in IMG/M |
3300028819|Ga0307296_10066231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1917 | Open in IMG/M |
3300028819|Ga0307296_10218003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1037 | Open in IMG/M |
3300028828|Ga0307312_10167526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1400 | Open in IMG/M |
3300028828|Ga0307312_10695502 | Not Available | 673 | Open in IMG/M |
3300028828|Ga0307312_10851439 | Not Available | 604 | Open in IMG/M |
3300030829|Ga0308203_1008137 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300030829|Ga0308203_1009179 | Not Available | 1110 | Open in IMG/M |
3300030829|Ga0308203_1025593 | Not Available | 795 | Open in IMG/M |
3300030902|Ga0308202_1016788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1102 | Open in IMG/M |
3300030903|Ga0308206_1070122 | Not Available | 736 | Open in IMG/M |
3300030903|Ga0308206_1093770 | Not Available | 663 | Open in IMG/M |
3300030916|Ga0075386_10055277 | Not Available | 842 | Open in IMG/M |
3300030916|Ga0075386_11366395 | Not Available | 586 | Open in IMG/M |
3300030916|Ga0075386_12178188 | Not Available | 963 | Open in IMG/M |
3300030945|Ga0075373_11524936 | Not Available | 719 | Open in IMG/M |
3300030989|Ga0308196_1040568 | Not Available | 616 | Open in IMG/M |
3300031057|Ga0170834_112614549 | Not Available | 886 | Open in IMG/M |
3300031058|Ga0308189_10270364 | Not Available | 651 | Open in IMG/M |
3300031082|Ga0308192_1065828 | Not Available | 569 | Open in IMG/M |
3300031091|Ga0308201_10373054 | Not Available | 529 | Open in IMG/M |
3300031092|Ga0308204_10270213 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300031093|Ga0308197_10076648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 935 | Open in IMG/M |
3300031093|Ga0308197_10287107 | Not Available | 601 | Open in IMG/M |
3300031094|Ga0308199_1169700 | Not Available | 532 | Open in IMG/M |
3300031170|Ga0307498_10016198 | Not Available | 1612 | Open in IMG/M |
3300031170|Ga0307498_10104214 | Not Available | 878 | Open in IMG/M |
3300031170|Ga0307498_10123831 | Not Available | 827 | Open in IMG/M |
3300031170|Ga0307498_10148912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
3300031170|Ga0307498_10488064 | Not Available | 501 | Open in IMG/M |
3300031199|Ga0307495_10010299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1357 | Open in IMG/M |
3300031226|Ga0307497_10031178 | Not Available | 1740 | Open in IMG/M |
3300031226|Ga0307497_10039796 | Not Available | 1589 | Open in IMG/M |
3300031226|Ga0307497_10120395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
3300031231|Ga0170824_111171642 | Not Available | 1076 | Open in IMG/M |
3300031231|Ga0170824_121573923 | Not Available | 843 | Open in IMG/M |
3300031231|Ga0170824_128033644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8866 | Open in IMG/M |
3300031446|Ga0170820_16158738 | Not Available | 560 | Open in IMG/M |
3300031545|Ga0318541_10035889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2487 | Open in IMG/M |
3300031547|Ga0310887_10010084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3422 | Open in IMG/M |
3300031573|Ga0310915_10206623 | Not Available | 1374 | Open in IMG/M |
3300031679|Ga0318561_10341118 | Not Available | 821 | Open in IMG/M |
3300031716|Ga0310813_11886289 | Not Available | 562 | Open in IMG/M |
3300031716|Ga0310813_11970810 | Not Available | 550 | Open in IMG/M |
3300031720|Ga0307469_10074625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2266 | Open in IMG/M |
3300031740|Ga0307468_100227774 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 1289 | Open in IMG/M |
3300031740|Ga0307468_101805589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
3300031744|Ga0306918_10029673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3440 | Open in IMG/M |
3300031751|Ga0318494_10577466 | Not Available | 657 | Open in IMG/M |
3300031764|Ga0318535_10144922 | Not Available | 1057 | Open in IMG/M |
3300031820|Ga0307473_11421258 | Not Available | 523 | Open in IMG/M |
3300031833|Ga0310917_10002115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9622 | Open in IMG/M |
3300031858|Ga0310892_10571107 | Not Available | 762 | Open in IMG/M |
3300031879|Ga0306919_10834669 | Not Available | 707 | Open in IMG/M |
3300031880|Ga0318544_10201272 | Not Available | 769 | Open in IMG/M |
3300031880|Ga0318544_10415142 | Not Available | 523 | Open in IMG/M |
3300031908|Ga0310900_10677298 | Not Available | 823 | Open in IMG/M |
3300031912|Ga0306921_12272564 | Not Available | 569 | Open in IMG/M |
3300031913|Ga0310891_10001113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5206 | Open in IMG/M |
3300031943|Ga0310885_10053179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SRL28 | 1689 | Open in IMG/M |
3300031945|Ga0310913_11299388 | Not Available | 505 | Open in IMG/M |
3300032000|Ga0310903_10403856 | Not Available | 696 | Open in IMG/M |
3300032010|Ga0318569_10551112 | Not Available | 537 | Open in IMG/M |
3300032075|Ga0310890_10439442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola | 978 | Open in IMG/M |
3300032076|Ga0306924_11118013 | Not Available | 858 | Open in IMG/M |
3300032122|Ga0310895_10143662 | Not Available | 1023 | Open in IMG/M |
3300032180|Ga0307471_100907153 | Not Available | 1048 | Open in IMG/M |
3300032180|Ga0307471_103477376 | Not Available | 557 | Open in IMG/M |
3300032180|Ga0307471_103715766 | Not Available | 540 | Open in IMG/M |
3300032205|Ga0307472_101201354 | Not Available | 724 | Open in IMG/M |
3300032261|Ga0306920_100050014 | All Organisms → cellular organisms → Bacteria | 6070 | Open in IMG/M |
3300032782|Ga0335082_10047793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4443 | Open in IMG/M |
3300032782|Ga0335082_10265233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1597 | Open in IMG/M |
3300032783|Ga0335079_10441351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1397 | Open in IMG/M |
3300033290|Ga0318519_10966511 | Not Available | 528 | Open in IMG/M |
3300033412|Ga0310810_10159668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2607 | Open in IMG/M |
3300033412|Ga0310810_10187887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2352 | Open in IMG/M |
3300033433|Ga0326726_10088134 | All Organisms → cellular organisms → Bacteria | 2759 | Open in IMG/M |
3300033433|Ga0326726_10875735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 870 | Open in IMG/M |
3300033433|Ga0326726_10936755 | Not Available | 841 | Open in IMG/M |
3300033433|Ga0326726_11482014 | Not Available | 660 | Open in IMG/M |
3300033433|Ga0326726_11491193 | Not Available | 658 | Open in IMG/M |
3300033433|Ga0326726_12149867 | Not Available | 543 | Open in IMG/M |
3300033500|Ga0326730_1030307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1094 | Open in IMG/M |
3300033500|Ga0326730_1041592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 901 | Open in IMG/M |
3300034090|Ga0326723_0027154 | Not Available | 2360 | Open in IMG/M |
3300034090|Ga0326723_0033033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2154 | Open in IMG/M |
3300034090|Ga0326723_0101386 | Not Available | 1245 | Open in IMG/M |
3300034090|Ga0326723_0133169 | Not Available | 1087 | Open in IMG/M |
3300034090|Ga0326723_0214369 | Not Available | 855 | Open in IMG/M |
3300034090|Ga0326723_0401174 | Not Available | 623 | Open in IMG/M |
3300034817|Ga0373948_0004562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2200 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.39% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.81% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.47% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.09% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.89% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.11% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.14% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.56% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.36% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.58% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.58% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.58% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.39% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.39% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.39% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.39% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.39% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.39% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.39% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.19% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.19% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.19% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.19% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.19% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.19% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.19% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.19% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025979 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026362 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 C6 | Environmental | Open in IMG/M |
3300026464 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS5 | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICI_03125160 | 2088090015 | Soil | MMRTAIISMLASFVLVGVWTINLVSYHPATDLNPLAPLSTNFN |
GPICI_01772170 | 2088090015 | Soil | MIRTAIISVTASIVLIGAWTINLVSYHPTNDLNPLAPLNAPVDWK |
cont_0825.00006040 | 2166559005 | Simulated | MIRTAIISVTASFVLFGAWAVNLVSYHPAPNLNPLAPLSAPVDGSR |
N56_03006290 | 2170459012 | Grass Soil | MIRTAIISMLASFVLIGVSTINLVSYHPATDLNPLAPLS |
deepsgr_00486060 | 2199352025 | Soil | MIRTAIISVTASFVLFGAWTVHLVSYHPTTDLNVGAAYHQH |
deepsgr_01598260 | 2199352025 | Soil | VIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLNTNVDGR |
deepsgr_02026720 | 2199352025 | Soil | MIRTAIISMLASFVLVGVWTINLVSYHPATDLNPIAPLSTNFD |
ICCgaii200_08632772 | 2228664021 | Soil | MMRTAIISMLASFVLVGVWTINLVSYHPATDLNPLAPLSTNFD |
ICCgaii200_08691132 | 2228664021 | Soil | IRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLNAPVDGK |
INPgaii200_10709502 | 2228664022 | Soil | MIRTAIISVTASVVLFGAWTINLVSYHPANDLNPLAPLSAPVDWK |
INPhiseqgaiiFebDRAFT_1004362192 | 3300000364 | Soil | MIRTVIISVVASFALVGAWTINLVSYHLGTDLNPLAPLSVQVD* |
INPhiseqgaiiFebDRAFT_1015683501 | 3300000364 | Soil | MIRTAIISVTASVVLFGAWTINLVSYHPANDLNPLAPLSAPVDWK* |
INPhiseqgaiiFebDRAFT_1015683514 | 3300000364 | Soil | MIRTAIISVTASIVLIGAWTINLVSYHPTNDLNPLAPLNAPVDWK* |
INPhiseqgaiiFebDRAFT_1042986512 | 3300000364 | Soil | TAIISVTASFVLFGAWTVNLVSYHPANDLNPLAPLNTNVGWK* |
F24TB_101797013 | 3300000550 | Soil | MIRTAIISVTASIVLIGTWTINLVSYHPTNDLNPLAPLNAPVDWK* |
F24TB_111840372 | 3300000550 | Soil | MMRTAIISVTASVVLFGAWAVNLIXXHPATDLNPLAPLNAP |
AF_2010_repII_A01DRAFT_10607642 | 3300000580 | Forest Soil | MIRTAIVSVTASFVLFGAWAVNLVSHHPATDLNPLAPLNAPIDWK* |
JGI11643J11755_115163863 | 3300000787 | Soil | MIRTAIISVTASIVLVGAWTINLVSYHPANDLNPLA |
JGI11643J11755_117709153 | 3300000787 | Soil | MRGKRDCVMMRTAIISMLASFVLVGVWTINLVSYHPATDLNPLAPLSTNFD* |
JGI1027J12803_1004558203 | 3300000955 | Soil | MIRTAIISVAASFVLFGVWAANLVSYHSAPDLKPLAPLSAPAEWK* |
JGI1027J12803_1016851935 | 3300000955 | Soil | MLASFVLVGVWTINLVSYHPATDLNPLAPLSTNFD* |
Ga0055438_101636552 | 3300003995 | Natural And Restored Wetlands | GKTKRSYVMIRTAIISMIASFVLIGAWTVNVVSYHPTTDLNPLAPLSVDWN* |
Ga0055437_101496542 | 3300004009 | Natural And Restored Wetlands | MIRTAIISVITSFVLVGVWTASLVSYHPATDLDPLAPLSVDWN* |
Ga0055436_100308161 | 3300004024 | Natural And Restored Wetlands | MIRTAIISMIASFVLIGAWTVNVVSYHPTTDLNPLAPLSVDWN* |
Ga0055436_100699012 | 3300004024 | Natural And Restored Wetlands | MIRTAIVSVIGSFLLVGAWTANLVSYHPTADLDPLAPLSVHID* |
Ga0055433_100332671 | 3300004025 | Natural And Restored Wetlands | MIRTAIISVTATFFLFGVWAVNLVSYHPTADLNPLAPLSLDGAWR* |
Ga0062590_1006242832 | 3300004157 | Soil | MIRTTIISVIASFVVFGAWIINEVSYHPAAGPNPLAPLSSNVD* |
Ga0063356_1050455341 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPVTDMNPLAPLTASFD* |
Ga0062595_1000414343 | 3300004479 | Soil | MIRTVIISVVASFALVSAWTINLVSYHPGTDLNPLAPLSVQVD* |
Ga0062595_1022066601 | 3300004479 | Soil | ADNKGSAVMIRTAIITVTASFVLFGAWTVNLVSYHPAKDLNPLAPLGTSVDWK* |
Ga0066395_102600821 | 3300004633 | Tropical Forest Soil | MIRTAIVSVTASFVLFGAWAVNLVSHHPATDLIPLAPLNAPVDWK* |
Ga0066395_103667731 | 3300004633 | Tropical Forest Soil | MIRTAIISVVASFALVGAWTVNLVSYHPGTDLNPLAPLSVQVD* |
Ga0062594_1010724462 | 3300005093 | Soil | MIRTAIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLSVPVDWK* |
Ga0062594_1025378711 | 3300005093 | Soil | MIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPVDWK* |
Ga0066815_100093653 | 3300005164 | Soil | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVDWR* |
Ga0066869_100961021 | 3300005165 | Soil | ISVTASFLLFGAWTVNLVSYHPAQDLNPLAPLSLKAGWK* |
Ga0068993_101197722 | 3300005183 | Natural And Restored Wetlands | MIRTAIVSVIGSFLLVGAWTANLVSYHPTEDLDPLAPLSVHID* |
Ga0068993_101913092 | 3300005183 | Natural And Restored Wetlands | MIRTAIVSVIGSFILVGVWTANLVSYHPTADLDPLAPLSVHID* |
Ga0068997_100080282 | 3300005204 | Natural And Restored Wetlands | MIRTAIISMIASFVLISAWTVNVVSYHPTTDLNPLAPLSVDWN* |
Ga0068999_100228652 | 3300005205 | Natural And Restored Wetlands | MIRTAIISVTASFVLFGAYAVNLVSYHPAPDLNPLAPLSAPVDWR* |
Ga0068998_100222023 | 3300005213 | Natural And Restored Wetlands | MILTAIISVIASFVLVGAWTANLVSYHPATDLDPLTPISVDWK* |
Ga0068996_100303893 | 3300005218 | Natural And Restored Wetlands | MIRTAIISVITSFVLVGVWTASLVSYHPATDLDPLAPLSVNWN* |
Ga0065704_105675861 | 3300005289 | Switchgrass Rhizosphere | LIRTVIISATAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVE* |
Ga0065705_103168083 | 3300005294 | Switchgrass Rhizosphere | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLNAPVDGK* |
Ga0070683_1006353741 | 3300005329 | Corn Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVD* |
Ga0070690_1002317623 | 3300005330 | Switchgrass Rhizosphere | IRTAIISVTASFVLFGAWTVNLVRYHPATDLNPLAPLSTDVDWR* |
Ga0066388_10000079920 | 3300005332 | Tropical Forest Soil | MIRTAIISMTASFVLFGVWTVNLISYHPATDLNPLAPLNTNIDWR* |
Ga0066388_1007021752 | 3300005332 | Tropical Forest Soil | MIRTVIISVTASIVLFGAWTIDLVRYHPATDLNPLAPLNTKIDWR* |
Ga0066388_1010511631 | 3300005332 | Tropical Forest Soil | MMRTAIISVTASVVLFGAWAVNLISYHPATNLNPLAPLSAPVHWK* |
Ga0066388_1011173231 | 3300005332 | Tropical Forest Soil | MIRTAIISVIVSFVLFGAWTVNLVSYHPATDINSLAPQSTSFD* |
Ga0066388_1011483472 | 3300005332 | Tropical Forest Soil | MIRTAIISMLASFVLVGVGTINLVSYHPATDLNPLAPLSTNFD* |
Ga0066388_1012186603 | 3300005332 | Tropical Forest Soil | MIRTAIVPVTASFVLLGAWAVNLVSYHPATDLNPLAPLSAPVDWK* |
Ga0066388_1012394582 | 3300005332 | Tropical Forest Soil | MIRTAIVSVTASFVLFGAWAVNLVSHHPATDLNPLAPLNAPVDWK* |
Ga0066388_1027031432 | 3300005332 | Tropical Forest Soil | MIRTAIISVVASFALVSAWTVNLVSYHPETDLNPLAPLSVQVD* |
Ga0066388_1053626781 | 3300005332 | Tropical Forest Soil | MIRTAIISVTASFVFLGAWTVNLVSYHPAKDLNPLAPLSTTTDWK* |
Ga0066388_1057553722 | 3300005332 | Tropical Forest Soil | MTRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTD |
Ga0066388_1062800941 | 3300005332 | Tropical Forest Soil | MIRTVVISVTASFILFGAWTVDLVRYHPATDLNPLAPLNTSVDWR* |
Ga0070666_103686971 | 3300005335 | Switchgrass Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVRYHPATDLNPLAPLSTDVDWR* |
Ga0070682_1009097331 | 3300005337 | Corn Rhizosphere | MVRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPVDWK* |
Ga0070668_1006058693 | 3300005347 | Switchgrass Rhizosphere | AIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLSAPVDWK* |
Ga0070675_1013517342 | 3300005354 | Miscanthus Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVN* |
Ga0070688_1007299722 | 3300005365 | Switchgrass Rhizosphere | MVRTAIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLSVPVDWK* |
Ga0070709_1000021922 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISVTASFVLFGAWTINLVSYHPATDINPLAPLSASFD* |
Ga0070709_100347801 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTILVSIAASFVLFSAWTINLVSYHPAHDLNPLAPLKTSVIVKQ* |
Ga0070709_103256024 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISMLASFVLVGVWTINLVSYHPATDLNPIAPLSTNFD* |
Ga0070709_109244222 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LIRTVIISATAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0070714_1010079732 | 3300005435 | Agricultural Soil | MLRTILVSIAASFVLVSAWTINLVSYHPAHDLNPLAPLKTSVIVKQ* |
Ga0070713_1005815001 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVDRR* |
Ga0070713_1008514542 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRTAIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLSAPVDWK* |
Ga0070713_1013331631 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRTVLISITASVVLVSAWTINLVSYHPTNDLNPLAPLKTTVTVKQ* |
Ga0070710_100123433 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLSAPVDWK* |
Ga0070711_1001915613 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISLTACFVLFGAWTVNLVSYHPATDLNPLAPLNHSVEWR* |
Ga0070711_1008937751 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISFTASFLLFGAWAVNLVSYHPAPNLNSLTPFTAPVDWK* |
Ga0070708_1001572282 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISVIASFVLVGAWTVSLVSYHPVTDLNPLAPLSTNVDWK* |
Ga0070708_1018524881 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISVIASFVLVSAWTVNLVSYHPATDLKPLAALSVDLK* |
Ga0070662_1006915781 | 3300005457 | Corn Rhizosphere | SAMIRTAIISVTALFGAWAVNLVSYHPAPNLNSLTPLSVPVDWK* |
Ga0070662_1015756252 | 3300005457 | Corn Rhizosphere | SAMIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLSPLNAPVDWK* |
Ga0070685_101399021 | 3300005466 | Switchgrass Rhizosphere | VMIRTAIISVTASFVLFGAWTINLVSYHPATDINPLAPLSASFD* |
Ga0070679_1010758482 | 3300005530 | Corn Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVRYHPATDLNPLAPLGTDVDWR* |
Ga0070693_1000487033 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISVTASFVLFSAWTVNLVRYHPATDLNPLAPLSTDVDWR* |
Ga0070693_1005703281 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | AIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPVDWK* |
Ga0070664_1003044822 | 3300005564 | Corn Rhizosphere | LIRTVIISVTAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVE* |
Ga0070664_1015931572 | 3300005564 | Corn Rhizosphere | MIRTAIISVTALFGAWAVNLVSYHPAPNLNSLTPLSAPVDWK* |
Ga0070702_1018966602 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISVTASFVLLGAWTINLVSYHPATDINPLAPLSASFD* |
Ga0068864_1000355759 | 3300005618 | Switchgrass Rhizosphere | QTRKSNRGSAMVRTAIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLSAPVDWK* |
Ga0066905_1000119552 | 3300005713 | Tropical Forest Soil | MVRTAIISVTASLVLFGAWTINLVSYRPATDLNPLAPLSGPVDWK* |
Ga0066905_1000235902 | 3300005713 | Tropical Forest Soil | MIRTAIISVTASGVLFGAWTINLVSYHLTNDLNPLAPLSAPVDWK* |
Ga0066905_1000613563 | 3300005713 | Tropical Forest Soil | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLKPLAPLSAPVDWK* |
Ga0066905_1002411292 | 3300005713 | Tropical Forest Soil | MIRTAIISMLASFVLVGVWTINLVSYHPAKDLNPLAPLSTNFD* |
Ga0066905_1003346232 | 3300005713 | Tropical Forest Soil | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDWK* |
Ga0066905_1005863942 | 3300005713 | Tropical Forest Soil | MMRTAIISVTASVVLFGAWAVNVISYHPATDLDPLAPLSAPADWK* |
Ga0066905_1006590773 | 3300005713 | Tropical Forest Soil | MIRTAIISVTASFVLFGAWAVNLVSYHPAADLNPLAPLSTPVDRR* |
Ga0066905_1007073173 | 3300005713 | Tropical Forest Soil | MIRTAIISVIALFVLVSAWTVNLVSYHPATDLNPLAPLSVDWH |
Ga0066905_1007423573 | 3300005713 | Tropical Forest Soil | MIRTAIISITASFVLFGAWAVNLVSYHPATDLNPLAPLSTPVDRR* |
Ga0066905_1007459191 | 3300005713 | Tropical Forest Soil | MIRTAIISVTASFLLFGAWAVNLVSYHPATDLNPLAPLSTPADRR* |
Ga0066905_1007780113 | 3300005713 | Tropical Forest Soil | SGSTTMIRTAIISIAASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDRR* |
Ga0066905_1009996601 | 3300005713 | Tropical Forest Soil | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPVAPLSAPVDGK* |
Ga0066905_1010061171 | 3300005713 | Tropical Forest Soil | MMRTAIISVTASVVLFGAWAVNLIRYHPATDLNPLAPLSAPVDGK* |
Ga0066905_1023047153 | 3300005713 | Tropical Forest Soil | IISMLASFVLVGVWTINLVSYHPATDLNPLAPLSTNFD* |
Ga0066903_1011235041 | 3300005764 | Tropical Forest Soil | MTRTAIISVIASFVLFGAWTVNLVSYHPATDLNPLAPLST |
Ga0066903_1011356553 | 3300005764 | Tropical Forest Soil | MIRTAIVSVTASFVLFGAWAVNLVSHHPATDLNALAPLNAPVDWK* |
Ga0066903_1012413073 | 3300005764 | Tropical Forest Soil | MIRTAIVSVTASFLLFGAWAVNLVGHHPATDLNPLAPLNAPVDWK* |
Ga0066903_1024923732 | 3300005764 | Tropical Forest Soil | MIRTAIVSVTASFVLFGAWAVNLVSHHPATDLNPLVPLNAPVDWK* |
Ga0066903_1066945012 | 3300005764 | Tropical Forest Soil | MIRTGIVSVTASFVLFGVWAVNLVSHHPATNLNPLAPLNAPVDWK* |
Ga0068860_1004420814 | 3300005843 | Switchgrass Rhizosphere | LIRTVIISVTAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0068860_1013958413 | 3300005843 | Switchgrass Rhizosphere | MIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLSPLNAPVDWK* |
Ga0068862_1014566251 | 3300005844 | Switchgrass Rhizosphere | MIRTAIISVTASFVLFSAWTVNLVRYHPATDLNPLAPLGTDVDWR* |
Ga0081455_100797922 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIRTAIISMLASFVLVGVWTINLVSYHPATDLNPLAPLSTNFD* |
Ga0081455_101927584 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIRTAIVSVTASFVLFGAGALNLVSYHPATDLNPLAPLNAPVDWK* |
Ga0081455_102056161 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RIAIVSVTASFVLFGDWAVNLVSYQPATDLNPLAPLSAPVDGK* |
Ga0070717_102532661 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTILVSIAASFVLVSAWTINLVSYHPAHDLNPLAPLKTSVI |
Ga0075023_1000561422 | 3300006041 | Watersheds | MIRTAIISVTASFVLFGAWTANLVSYHPATDINPLAPLSTTEWR* |
Ga0075023_1001740711 | 3300006041 | Watersheds | IKGAVMIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSATFD* |
Ga0075023_1003121502 | 3300006041 | Watersheds | MMRTVLISITASFVLVGAWTINLVSYHPAKDLNPLAPLKTTVIVKQ* |
Ga0075024_1000528732 | 3300006047 | Watersheds | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSATFD* |
Ga0075024_1002357653 | 3300006047 | Watersheds | VMIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVDGR* |
Ga0075024_1004698893 | 3300006047 | Watersheds | MIRTAIISVVASFVLVGAWTVSLVSYHPATDLNPLAPLSTNVE* |
Ga0075417_100586461 | 3300006049 | Populus Rhizosphere | MIRTAIISVIVSFVLVSAWTVNLVSYPPATDLNPLAPVSIDWN* |
Ga0075417_100764701 | 3300006049 | Populus Rhizosphere | MIRTAIVSVTASFVLFGAWAVNLVTYHPATDLNPLAPLNAPVDWK* |
Ga0075417_102849283 | 3300006049 | Populus Rhizosphere | MIRTAIASVTASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDWK* |
Ga0075417_103887213 | 3300006049 | Populus Rhizosphere | MIRTAIISMLASFVLVGVWTINLVSYHPATDLNPLA |
Ga0075417_107084242 | 3300006049 | Populus Rhizosphere | TTMIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLNAPVDGK* |
Ga0075028_10000273511 | 3300006050 | Watersheds | MIRTAIISVVASFVLVGAWTVSLVSYHPATDLKPLASLSTNVE* |
Ga0075028_1000052413 | 3300006050 | Watersheds | MIRTAIISVTASFVLFGAWTANLVSYHPAKDLNPMTPLSTTVEWR* |
Ga0075028_1008085772 | 3300006050 | Watersheds | AIISVTASFVLFGAWTANLVSYHPATDINPLAPLSTTEWR* |
Ga0075026_1007860031 | 3300006057 | Watersheds | MIRTAIISVTASFVLFGAWTVNLVRYHPATDLNPLAPLNTNVDWR* |
Ga0075026_1007890011 | 3300006057 | Watersheds | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVDGR* |
Ga0075432_101063201 | 3300006058 | Populus Rhizosphere | SVIVSFVLVSAWTVNLVSYPPATDLNPLAPVSIDWN* |
Ga0075019_104986812 | 3300006086 | Watersheds | MIRTAIISVVASFVLVGAWTVSLVSYHPAADLNPLA |
Ga0075015_1005872972 | 3300006102 | Watersheds | MIRTAIISVVASFVLVGAWTVSLVSYHPAADLNPLAPLSTNVE* |
Ga0075018_107509671 | 3300006172 | Watersheds | MIRTAIISVAASFVLVGVWAVNLVSYHSAPDLNPLAPLSAPAERK* |
Ga0070716_1004046612 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISVAASFVLFGVWAANLVSYHSAPDLNPLAPLSAPAEWK* |
Ga0070716_1010583111 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GSTVMIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVDRR* |
Ga0075422_100003633 | 3300006196 | Populus Rhizosphere | MIRTAIISVTASIVLIGAWTINLVSYHPTIDLNPLAPLNAPVDWK* |
Ga0075422_101306513 | 3300006196 | Populus Rhizosphere | TMIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLNAPVDGK* |
Ga0075422_105126821 | 3300006196 | Populus Rhizosphere | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPL |
Ga0079220_105677272 | 3300006806 | Agricultural Soil | MIRTAIISVTASFMLFGAWTINFVSYHPATDINPLAPLSASFD* |
Ga0079220_107709362 | 3300006806 | Agricultural Soil | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLNTNVGWK* |
Ga0075430_1006223032 | 3300006846 | Populus Rhizosphere | MIRTAIASVTASFVLFGAWAVNLVSYHPATDLNPLAPLSALVDWK* |
Ga0075431_1014687771 | 3300006847 | Populus Rhizosphere | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDRK* |
Ga0075431_1021006552 | 3300006847 | Populus Rhizosphere | ASFVLFGAWAVNLVYHPATDLSPLAPLSAPVDRK* |
Ga0075433_100327367 | 3300006852 | Populus Rhizosphere | MIRAAIVSVMASFVLFGAWAVNLVYHPATDLSPLAPLSAPVDRK* |
Ga0075425_1000132763 | 3300006854 | Populus Rhizosphere | MIRTAIISVTASVVLLGAWTINLVSYHPANDLNPLAPLSAPVDWK* |
Ga0075425_1009663981 | 3300006854 | Populus Rhizosphere | MIRTAIISMLASFVLVGVWTINLVSYHPATDLNPLAPLST |
Ga0075425_1010792941 | 3300006854 | Populus Rhizosphere | SVTAAFVLFSAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0075425_1011213151 | 3300006854 | Populus Rhizosphere | SVTASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDWK* |
Ga0075425_1030275391 | 3300006854 | Populus Rhizosphere | MIRTAIISVIASFVLVSAWTVNLISYHPATDLNPLAPLSIDWN* |
Ga0075434_1003794261 | 3300006871 | Populus Rhizosphere | MICTAIISVTASVVLFGAWTINLVSYHPANDLNPLAPLSAPVDWK* |
Ga0075434_1007398803 | 3300006871 | Populus Rhizosphere | LISTVIISATAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVE* |
Ga0075434_1026008121 | 3300006871 | Populus Rhizosphere | TAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0075429_1001443531 | 3300006880 | Populus Rhizosphere | TTMIRTAIVSVTASFVLFGAWAVNLVTYHPATDLNPLAPLNAPVDWK* |
Ga0075424_1011871413 | 3300006904 | Populus Rhizosphere | LIRTVIISVTAAFVLFSAWAINLVSYHPAPDLNRL |
Ga0075424_1012963851 | 3300006904 | Populus Rhizosphere | KRDCVMIRTAIISMLASFVLVGVWTINLVSYHPATDLNPIAPLSTNFD* |
Ga0075424_1022038373 | 3300006904 | Populus Rhizosphere | MIRNSVAASFVLFGVWAANLVSYHSAPDLNPLAPLSAP |
Ga0075424_1026894761 | 3300006904 | Populus Rhizosphere | RTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPVDWK* |
Ga0075436_1001327221 | 3300006914 | Populus Rhizosphere | RAAPKLASFVLFGAWAVNLVSYHPTTDLNPLAPLNAPVDRK* |
Ga0075436_1003709422 | 3300006914 | Populus Rhizosphere | MTRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPVDWK* |
Ga0075436_1004727561 | 3300006914 | Populus Rhizosphere | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLGAPVDWK* |
Ga0075436_1007901523 | 3300006914 | Populus Rhizosphere | VIISVVASFALVSAWTINLVSYHPGTDLNPLAPLSVQVD* |
Ga0079219_119458892 | 3300006954 | Agricultural Soil | MIRTAIISLTACFVLFGAWTVNLVSYHPATDLNPLAPLSHSVEWR* |
Ga0075419_104672372 | 3300006969 | Populus Rhizosphere | MIRTAIISVIVSFVLVSVWTVNLVSYPPATDLNPLAPVSIDWN* |
Ga0075419_110611253 | 3300006969 | Populus Rhizosphere | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLN |
Ga0075435_1000284479 | 3300007076 | Populus Rhizosphere | AAIVSVMASFVLFGAWAVNLVYHPATDLSPLAPLSAPVDRK* |
Ga0075435_1002154872 | 3300007076 | Populus Rhizosphere | SVVLFGAWTINLVSYHPANDLNPLAPLSAPVDWK* |
Ga0075435_1015949652 | 3300007076 | Populus Rhizosphere | MTRTAIISVTASFLLFGAWAVNLASYHPAPNLNSLTPLSAPVDWK* |
Ga0105095_101448351 | 3300009053 | Freshwater Sediment | MIRTILISVTASFILMGAWTVNLVSPHPAVDQALNPLSPLTTTAEWQQ* |
Ga0105250_101106903 | 3300009092 | Switchgrass Rhizosphere | IISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLSVPVDWK* |
Ga0111539_130827182 | 3300009094 | Populus Rhizosphere | IISVVASFALVSAWTINLVSYHPGTDLNPLAPLSVQVD* |
Ga0075418_101973805 | 3300009100 | Populus Rhizosphere | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLNAPVDWK* |
Ga0075418_107909413 | 3300009100 | Populus Rhizosphere | TASVVLFGAWAVNLISYHPATDLNPLAPLSAPVDWK* |
Ga0066709_1014622701 | 3300009137 | Grasslands Soil | MIRTAIITVTASFVLFGAWTVNLVSYHPAKDLNPLAPFSTNVDWK* |
Ga0114129_106039631 | 3300009147 | Populus Rhizosphere | MIRTAIISMLASFVLGGVWTINLVSYHPATDLNPLAPLSTNFD* |
Ga0114129_113968181 | 3300009147 | Populus Rhizosphere | MIRTAIASVTASFVLFGAWAVNLVSYHPATDLNPLAPLSA |
Ga0114129_125740281 | 3300009147 | Populus Rhizosphere | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPL |
Ga0114129_133513551 | 3300009147 | Populus Rhizosphere | STTMIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLGAPVDWK* |
Ga0075423_100277247 | 3300009162 | Populus Rhizosphere | MIRTAIISVIVSFVLVSAWTVNLVSYHPATDLNPLAPLSIDWN* |
Ga0075423_101471173 | 3300009162 | Populus Rhizosphere | AIISMLASFVLVGVWTINLVSYHPATDLNPLAPLSTNFD* |
Ga0075423_102961122 | 3300009162 | Populus Rhizosphere | MIRTAIVSVTASFVLFGAWAVNLLAPLSAPVDGK* |
Ga0075423_104965351 | 3300009162 | Populus Rhizosphere | GSTTMIRTAIVSVTASFVLFGAWAVNLVTYHPATDLNPLAPLNAPVDWK* |
Ga0105104_100774133 | 3300009168 | Freshwater Sediment | MMHTAIISVTASVVLFGAWAVNLISYHPVADLNPLAPLSVPVDWK* |
Ga0105104_102178382 | 3300009168 | Freshwater Sediment | MIRTAIVSVTASFVLLGAWAVNLVSYHPATDLNPLAPLNAPVDGK* |
Ga0105238_103653371 | 3300009551 | Corn Rhizosphere | MIRTAIISVTASFVLFSAWTVNLVRYHPATDLNPLAPL |
Ga0105238_107385223 | 3300009551 | Corn Rhizosphere | MIRTAIISVTALFGAWAVNLVSYHPAPNLNSLTPLSASVDWK* |
Ga0126374_110662983 | 3300009792 | Tropical Forest Soil | MIRTAIISIAASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDWR* |
Ga0126374_114006831 | 3300009792 | Tropical Forest Soil | MIRTVIISVTASFVLFGAWTVDLVRYHPATDLNPLAPLNTNVDWR* |
Ga0126380_106577522 | 3300010043 | Tropical Forest Soil | TAMIRTAIVSVTASFVLFGAWAVNLVSHHPATDLNPLAPLNAPVDWK* |
Ga0126380_109240581 | 3300010043 | Tropical Forest Soil | MIRTAIVSVTASFVLFGAWAVNLVSYQPATGLNSLAPLSAPVDWK* |
Ga0126384_106033642 | 3300010046 | Tropical Forest Soil | MIRTAIISVIALFVLVSAWTVNLVSYHPATDLNPLAPLSVDWH* |
Ga0126384_111596132 | 3300010046 | Tropical Forest Soil | SIAASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDRR* |
Ga0126384_113699922 | 3300010046 | Tropical Forest Soil | MIRTAIISIAASFVLFGAWAVNLVSYHPATDLNPLAPLSA |
Ga0126384_120336151 | 3300010046 | Tropical Forest Soil | MTRTAIISMTASFVLFGVWTVNLISYHPATDLNPLAPLNTNIDWR* |
Ga0126384_123627141 | 3300010046 | Tropical Forest Soil | MMRTAIISVTASVVLFGAWAVNLISYHPATDLNPLAPLSAPV |
Ga0126382_100669223 | 3300010047 | Tropical Forest Soil | MIRTAIISIAASFVLFGAWAVNLVSYHPATDLNPLTPLSAPVDRR* |
Ga0126382_102322931 | 3300010047 | Tropical Forest Soil | SSGSTTMIRTAIISVTASFLLFGAWAVNLVSYHPATDLNPLAPLSTPVDRR* |
Ga0126382_109551182 | 3300010047 | Tropical Forest Soil | MIRTAIISVTASLVLFGAWTINLVSYRPATDLNPLAPLSGPVDWK* |
Ga0126382_114853432 | 3300010047 | Tropical Forest Soil | SFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDWK* |
Ga0126382_122999811 | 3300010047 | Tropical Forest Soil | MIRTAIVSVTASFVLFGAWAVNLISYHPATDLNPLAPLNAPVDWK* |
Ga0127503_102153492 | 3300010154 | Soil | MIRTTIISVTASFVLLGAWAVNLVSYHPAPDLNPLAPLSAPVDGK* |
Ga0127503_105834661 | 3300010154 | Soil | MIRTAIISVAASFVLVGVWAVNLVSYHSAPDLNPLAPLSAPAEWK* |
Ga0126376_100520254 | 3300010359 | Tropical Forest Soil | MIRTAIISIAASFVLFGAWAVNLVSYHPATDLNPLAPLSTPADRR* |
Ga0126376_108571202 | 3300010359 | Tropical Forest Soil | MIRTVVISVTASFILFGAWTVDLVRYHPATDLNPLAPLNTSIDWR* |
Ga0126376_119090982 | 3300010359 | Tropical Forest Soil | MIRTAIVPVTASFVLLGAWAVNLVSYHPATDLNRLAPLSAPVDWR* |
Ga0126372_120086251 | 3300010360 | Tropical Forest Soil | AIISMLASFVLVGVWTINLVGYHPATDLNPLAPLSTNFD* |
Ga0126372_125637502 | 3300010360 | Tropical Forest Soil | MICTAIVSVTSSFVVLGAWAVNLVSHHPATDLNPLAPLNAPVDWK* |
Ga0126378_102731732 | 3300010361 | Tropical Forest Soil | MIRTAIISVTESFLLFGAWAVNLVSYHPATDLNPLAPLSTPADRR* |
Ga0126377_103641302 | 3300010362 | Tropical Forest Soil | IISITASFVLFGAWAVNLVSYHPATDLNPLAPLSTPVDRR* |
Ga0126377_106693433 | 3300010362 | Tropical Forest Soil | MNNGSTAMMRTAIISVTASVVLFGVWAVNIISYHPATDLNPLAPLSAPVHWK* |
Ga0126377_122211461 | 3300010362 | Tropical Forest Soil | MIRTAIVSVTASFVLFGAWAVNLVSYHPAADLNPLAPLSASVDWK* |
Ga0126377_129854951 | 3300010362 | Tropical Forest Soil | MIRTAIISIAASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDRR* |
Ga0126379_117507423 | 3300010366 | Tropical Forest Soil | MIRTAIISVVASFALVSAWTVNLVSYHPGTDLKPLAPL |
Ga0134125_111139942 | 3300010371 | Terrestrial Soil | GSTVMIRTAIISLTACFVLFGAWTVNLLSYHPATDLNPLAPLNHSVEWR* |
Ga0134128_126754091 | 3300010373 | Terrestrial Soil | LIRTVIISVTAAFVLFSAWAINLVSYHPAPDLNRLAQLSAPVE* |
Ga0134128_129550072 | 3300010373 | Terrestrial Soil | VIISVTAAFVLFGAWAINLVSHHPAPDLNRPAQLSTPVEWN* |
Ga0126381_1013489684 | 3300010376 | Tropical Forest Soil | MIRTAIISVVASFALVSAWTVNLVSYHPWTGLNPLAPLSVQVD* |
Ga0126381_1036503502 | 3300010376 | Tropical Forest Soil | SGSPAMIRTAIVCVTASFVLFGAWAVNLVSHHPATDLNPLAPLNAPVDWK* |
Ga0126383_100387761 | 3300010398 | Tropical Forest Soil | STVMIRTVLISVTASIVLFGAWTIDLVRYHPATDLNPLAPLNTKIDWR* |
Ga0126383_100759062 | 3300010398 | Tropical Forest Soil | MIRTAIISVTASFVFLGAWTVNLVSYHPAKDLNPLAPLSATTDWR* |
Ga0134122_100147766 | 3300010400 | Terrestrial Soil | MIRTAIICVTASFVLFGAWTVNLVSYHPATDLNPLAPLRATFD* |
Ga0134121_103619611 | 3300010401 | Terrestrial Soil | MIRTAIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLSVPV |
Ga0134121_120928422 | 3300010401 | Terrestrial Soil | AIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLSVPVDWK* |
Ga0134121_124922921 | 3300010401 | Terrestrial Soil | MVRTAIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPL |
Ga0134123_113355061 | 3300010403 | Terrestrial Soil | LIRTVIISVTAAFVLFSAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0124850_10539724 | 3300010863 | Tropical Forest Soil | MIRTAIISVVAPFVLVGVWTADLVSYHPAMDPNPLASPSSPIPDDRI |
Ga0138513_1000138332 | 3300011000 | Soil | MIRTAIISVTASFLLFGAWAVNLVSYHPAPDLNPLAPLSAPVEWK* |
Ga0137391_107330071 | 3300011270 | Vadose Zone Soil | MIRTAIISVIASFVLVGAWTVSLVSYHPATDLNPLAPLSTNVD* |
Ga0137376_108497802 | 3300012208 | Vadose Zone Soil | MIRTAIISMLASFVLVGVCTINLVSYHPATDLNPLAPLSTNFD* |
Ga0157335_10304652 | 3300012492 | Arabidopsis Rhizosphere | MIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLT |
Ga0157355_10455731 | 3300012493 | Unplanted Soil | LIRTVIISVTAAFVLFSAWAINLVSYHPAPDLNRLAQLS |
Ga0157323_10212961 | 3300012495 | Arabidopsis Rhizosphere | LIRTVIISVTAAFVLFGAWAINLVSYHPAPDLNRVAQLSAPVER |
Ga0157319_10065301 | 3300012497 | Arabidopsis Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPATDMNPLAPLTASFD* |
Ga0157345_10612081 | 3300012498 | Arabidopsis Rhizosphere | GSTVMIRTAIISVTASFVLFGAWTVNLVSYHPAADLNPLAPLSTNVDWR* |
Ga0157350_10212132 | 3300012499 | Unplanted Soil | LIRTVVISVTAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0157339_10013521 | 3300012505 | Arabidopsis Rhizosphere | TAIISVTASFVLFGAWTINLVSYHPATDINPLAPLSASFD* |
Ga0157339_10378651 | 3300012505 | Arabidopsis Rhizosphere | MIRTAIISVTASFVLFGAWTINLVSYHPATDINPLAPLSASFH* |
Ga0157326_10150542 | 3300012513 | Arabidopsis Rhizosphere | IISVTASFVLFGAWTVYLVSYHPVTDMNPLAPLTASFD* |
Ga0153915_104812702 | 3300012931 | Freshwater Wetlands | MMRTILISITASFVLVGAWTINLVSYHPAKDLNPLAPLKTTAILKQYAS* |
Ga0162653_1000733332 | 3300012937 | Soil | NNRSSAMIRTAIISVTASFLLFGAWAVNLVSYHPAPDLNPLAPLSAPVDWK* |
Ga0162651_1000264771 | 3300012938 | Soil | MIRTAIISVTASFVLFGAWAVNLVSYHPAPDLNALAPLSAPVDWK* |
Ga0126375_104884001 | 3300012948 | Tropical Forest Soil | KRDCVMIRTAIISMLASFVLVGVWTINLVSYHPATDLNPLAPLSTNFD* |
Ga0126375_111215501 | 3300012948 | Tropical Forest Soil | MIRTAIISITASFVLFGAWAVNLVSYHPATNLNPLAPLSTPVDRR* |
Ga0126375_111952663 | 3300012948 | Tropical Forest Soil | ASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDRR* |
Ga0164300_100205122 | 3300012951 | Soil | MIRTALISVTASFVLFGAWTINLVSYHPATDINPLAPLSASFD* |
Ga0164300_103900421 | 3300012951 | Soil | MIRTTIISVIASFVVFGAWIINEVSYHPAAVPNPLAPLSSNVD* |
Ga0164303_101600253 | 3300012957 | Soil | MIRTAIISVTASFLLFGAWTVNLVRYHPATDLNPLAPLSTDVDWR* |
Ga0164299_100392654 | 3300012958 | Soil | MIRTAIISVTASFVLFGAWTVILVRYHPATDLNPLAPLSTYVDWR* |
Ga0164299_115782381 | 3300012958 | Soil | VTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVD* |
Ga0164301_104184042 | 3300012960 | Soil | VTASFVLFGAWTVNLVSYHPAKDLNPLAPLGTSVDWK* |
Ga0164301_105997861 | 3300012960 | Soil | SVTAAFVLFSAWAINLVSYHPAPDLNRLAQLSAPLE* |
Ga0164302_110147902 | 3300012961 | Soil | MIRTAITASFVLFGAWAVNLVSHHPTTDLNPLAPLNAPVDRK* |
Ga0164302_110869441 | 3300012961 | Soil | MIRTAIISVTASFVLFGAWTVNLVRYHPATDLNPLAPLSTD |
Ga0126369_107593732 | 3300012971 | Tropical Forest Soil | MIRTAIISMTASFVLFGAWTVNLVSYHPATDLNPLAPLSTDIDWR* |
Ga0126369_114340922 | 3300012971 | Tropical Forest Soil | VIISVTASFVLFGAWTIDLVRYHPATDLNPLAPLNTKIDWR* |
Ga0164309_107812491 | 3300012984 | Soil | MMRTVLISITASFVLVSAWTINLVSYHPTNDLNPLAPLKTTVTVKQ* |
Ga0164309_113057581 | 3300012984 | Soil | IISLTACFVLFGAWTVNLVSYHPATDLNPLAPLNHSVEWR* |
Ga0164309_118407842 | 3300012984 | Soil | MIRTAITASFVLFGAWAVNLVSHHPTTDLNPLAPLNAPVDWK* |
Ga0164304_100030871 | 3300012986 | Soil | MICTAIISVTASFVLFGAWTVNLVSYHPVTDMNPLAPLTASFD* |
Ga0164304_100804931 | 3300012986 | Soil | RTAIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLGVPVDWK* |
Ga0164304_111621711 | 3300012986 | Soil | MIRTAIISVTASFVLFGAWTVNLVSYHPANDLNPLAPLNTNVGWK* |
Ga0164307_107090522 | 3300012987 | Soil | SKLAKLTECSAMIRTAIISVAASFVLFGVWAANLVSYHSAPDLNPLAPLSAPAEWK* |
Ga0164306_103106913 | 3300012988 | Soil | VASFALVSAWTINLVSYHPGTDLNPLAPLSVQVD* |
Ga0157374_111314252 | 3300013296 | Miscanthus Rhizosphere | MLRTILVSIAASFVLVSAWTVNLVSYHPAHDLNPLAPLKTSVIVKQ* |
Ga0163162_108621702 | 3300013306 | Switchgrass Rhizosphere | SVTAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0163162_120478021 | 3300013306 | Switchgrass Rhizosphere | TAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVE* |
Ga0163162_125250931 | 3300013306 | Switchgrass Rhizosphere | RTAIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLSAPVDWK* |
Ga0075354_10490291 | 3300014308 | Natural And Restored Wetlands | MIRTAIISVTASFVFFGAWTVNLVSYHPANDLNPLAPLSKS |
Ga0075354_10685872 | 3300014308 | Natural And Restored Wetlands | MIRTAIITVTASFVLFAAWTVNLVSYHPANDLNPLAPLSVDLN* |
Ga0075351_10097731 | 3300014318 | Natural And Restored Wetlands | MIRTAIISVTASFVLFGVWTVNLVSYHPANDLNPLAPLSTTVGWK* |
Ga0075353_10410012 | 3300014321 | Natural And Restored Wetlands | MIRTAIISMIASFVLVGAWTVNIVSYHPTTDLNPLAPLSVDWN* |
Ga0075353_11210141 | 3300014321 | Natural And Restored Wetlands | MIRTAIISVTASFVFFGAWTVNLVSYHPANDLNPLAPL |
Ga0163163_104753732 | 3300014325 | Switchgrass Rhizosphere | LIRTVIISVTAAFVLFGAWAINLVSHHPAPDLNRLAQLSTPVEWN* |
Ga0157379_123082142 | 3300014968 | Switchgrass Rhizosphere | LISTVIISATAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPLE* |
Ga0157379_124136251 | 3300014968 | Switchgrass Rhizosphere | VTAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0157376_102516103 | 3300014969 | Miscanthus Rhizosphere | MIRPAIISVTASFVLFSAWTVNLVRYHPATDLNPLAPLSTDVDWR* |
Ga0132258_102083592 | 3300015371 | Arabidopsis Rhizosphere | MIRTVIISVTASFVLFGAWTIDLVRYHPATDLNPLAPLNTKIDWR* |
Ga0132258_104951507 | 3300015371 | Arabidopsis Rhizosphere | AAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0132258_108044494 | 3300015371 | Arabidopsis Rhizosphere | MIRTAIISVFGSFVLVGAWTINLVSYHPATDLNPLAPLSVHID* |
Ga0132258_112071874 | 3300015371 | Arabidopsis Rhizosphere | LIRTVIISLTAAFVLFGAWAINLVSYHPAPDLNRLAQLS |
Ga0132258_119520075 | 3300015371 | Arabidopsis Rhizosphere | SFVLFGAWTVNLVSYHPANDLNPLAPLNTNVGWK* |
Ga0132258_137465862 | 3300015371 | Arabidopsis Rhizosphere | MIRTVIISVTASFVLFGAWTIDLVRYHPATDLNPLAPLKTNVDWR* |
Ga0132256_1006360173 | 3300015372 | Arabidopsis Rhizosphere | MIRTAIISVIGSFVLFGAWTVNLVSYHPTTDLNPLAPFSVHIDR |
Ga0132256_1014197331 | 3300015372 | Arabidopsis Rhizosphere | MAVSAAFVLFSAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0132256_1014591103 | 3300015372 | Arabidopsis Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYPPATDMNPLAPLT |
Ga0132256_1014799661 | 3300015372 | Arabidopsis Rhizosphere | TRKSNRGSAMIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSTPVDWK* |
Ga0132256_1024903431 | 3300015372 | Arabidopsis Rhizosphere | TASFVLFGAWTVNLVRYHPATDLNPLAPLSTNVDWR* |
Ga0132255_10004378511 | 3300015374 | Arabidopsis Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPAADLNPLAPLSTNVDWR* |
Ga0132255_1014076461 | 3300015374 | Arabidopsis Rhizosphere | MIRTVVISVTAAFVLLGAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0132255_1016101101 | 3300015374 | Arabidopsis Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTDVDWR* |
Ga0132255_1032571011 | 3300015374 | Arabidopsis Rhizosphere | IISVTAAFVLFSAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0132255_1056713432 | 3300015374 | Arabidopsis Rhizosphere | LIRTVIISLTAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVEWN* |
Ga0182041_1000072718 | 3300016294 | Soil | RTAIVSVTASFVLFGAWAVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0182034_105338532 | 3300016371 | Soil | MIRTAIISVAASFALVSAWTVNLVSYHPGPDLNPLAPLSVQVEQIADYDHM |
Ga0182040_108914691 | 3300016387 | Soil | MIRTAIISVAASFALVSAWTVNLVSYHPGPDLNPLAPLSVQV |
Ga0187775_100630253 | 3300017939 | Tropical Peatland | MIRTAIISVTASFVLFGAWTINVVSYHPANDLNPLAPLSTSVWK |
Ga0187786_100108242 | 3300017944 | Tropical Peatland | MIRTAIISVTASFVVFGVWTANLVSYHPAKDLNPLAPLNTTVDWK |
Ga0187786_104828841 | 3300017944 | Tropical Peatland | MIRTAIISVTASFVVFGVWTANLVSYDPAKDLNPLAPLDTTV |
Ga0187785_100016923 | 3300017947 | Tropical Peatland | MIRTAIISVTASFVVFGVWTANLVSYDPAKDLNPLAPLDTTVDWK |
Ga0187785_100017742 | 3300017947 | Tropical Peatland | MIRTAIFSLTACFVVFGVWTASLVSYHPAKDLNPLAPLNTTVDWK |
Ga0187785_102009301 | 3300017947 | Tropical Peatland | MIRTVIISVTASIVLFGAWTIDLVRYHPATDLNPLAPLNTKID |
Ga0187785_102444781 | 3300017947 | Tropical Peatland | MIRTAIISVTASFVLFGAWTVNLVSYHPATDINPLAPLSTSFD |
Ga0187785_102868342 | 3300017947 | Tropical Peatland | MIRTAIISVTASFVLFGAWTVNLVSYHPANDLNPLAPLHTNVGWK |
Ga0187779_100064196 | 3300017959 | Tropical Peatland | MIRTAIISVTASFILFGAWTVNLVSYHPANDLNPLAPLHTNVGWK |
Ga0187779_102030312 | 3300017959 | Tropical Peatland | VRTAIIFVTASFVLFGAWTVNLVSYYPANDLNPLAPPSTNIGRK |
Ga0187778_100265842 | 3300017961 | Tropical Peatland | MVRTAIIFVTASFVLFGAWTVNLVSYYPANDLNPLAPPSTNIGRK |
Ga0190266_105086773 | 3300017965 | Soil | MIRTAIISVTASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDWK |
Ga0187776_100088293 | 3300017966 | Tropical Peatland | MFRTAIISVTASFVLFGAWTINLVSYHPANDLNPLTPLHTDVGGK |
Ga0187776_110846891 | 3300017966 | Tropical Peatland | MIRTAIISVTTSFVLFGAWTVNLVSYHPAKDLNPLAPLSTSVDWK |
Ga0187777_100022035 | 3300017974 | Tropical Peatland | MIRTAIISVTASFILFGAWTVNLVSYQPANDLNPLAPLHTNVGWK |
Ga0187777_100394252 | 3300017974 | Tropical Peatland | MIRTAIISLTASFVLFGAWTVNLVSYHQATDINPLAPLSTSFD |
Ga0187767_102298451 | 3300017999 | Tropical Peatland | TVMVRTAIIFVTASFVLFGAWTVNLVSYYPANDLNPLAPLSTNIGRK |
Ga0184604_101170192 | 3300018000 | Groundwater Sediment | MIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPVDWK |
Ga0184605_104495062 | 3300018027 | Groundwater Sediment | MIRTAVISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPVDWK |
Ga0184608_100312594 | 3300018028 | Groundwater Sediment | MIRTAIISVTASFVLFGAWAVNLVSYRPAPDLNPLAPLSAPVDR |
Ga0184608_102566452 | 3300018028 | Groundwater Sediment | MGKNNRSVGMIRTAIISVTASFVLFCAWAINLASYQPATDLNPLAPLSVPVD |
Ga0184608_102864621 | 3300018028 | Groundwater Sediment | MIRTAIISMLASFVLVGVWTINLVSYHPATDLNPLAPLSTNFD |
Ga0187787_100101464 | 3300018029 | Tropical Peatland | MIRTAIISVTASFVLFGTWTINVVSYHPANDLNPLAPLSTSVWK |
Ga0187788_105499982 | 3300018032 | Tropical Peatland | IRTAIISVTASFVLFGAYAVNLVSYHPAPDLNPLAPLNAPVDWR |
Ga0184620_102509442 | 3300018051 | Groundwater Sediment | MIRTAIISVTASFVLFGAWAVNLVSYHPAPDLNPLAPLSAPVDRK |
Ga0184626_104180632 | 3300018053 | Groundwater Sediment | MIRTAIASVTASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDWK |
Ga0184621_102198981 | 3300018054 | Groundwater Sediment | MIRTAIISVTASFVLFGAWAVNLVSYHPAPDPNSLTPLSAPVDWK |
Ga0187765_100194535 | 3300018060 | Tropical Peatland | MIRTAIISLTASFVLFGAWTVNLVSYHPATDINPLAPLSTSFD |
Ga0187765_100501411 | 3300018060 | Tropical Peatland | MIRTVIISVTASFVLFGAWTIDLVRYHPATDLNPLAPLDTKVDWR |
Ga0184611_10389901 | 3300018067 | Groundwater Sediment | REPVMIRTAIISITASFLLFGVWTINLVSYHPATDLNPLAPFSAPVDWK |
Ga0184611_12255482 | 3300018067 | Groundwater Sediment | MIRTAIISVAASFVLVGVWAINLVSYHSAPDLNPLAPLSAPAEWK |
Ga0184611_12913431 | 3300018067 | Groundwater Sediment | MMRTAIISVTASVVLFGTWAVSLISYHPATDLNPLAPLSAPVDWKWK |
Ga0184635_100019508 | 3300018072 | Groundwater Sediment | MIRTAIISITASFLLFGVWTINLVSYHPATDLNPLAPFSAPVDWK |
Ga0184635_100705223 | 3300018072 | Groundwater Sediment | MMRTAIISVTASVVLFGAWAVSLISYHPATDLNPLAPLSAPVDWK |
Ga0184635_101398602 | 3300018072 | Groundwater Sediment | MIRTAIISVIASFVLVSAWTVNLVSYHPATDLNPLAPLSVDRN |
Ga0184635_101444022 | 3300018072 | Groundwater Sediment | MIRTAIISVTASFVLFGAWAVNLVSYHPAPDLNPLAPLSAPVEWK |
Ga0184624_100085372 | 3300018073 | Groundwater Sediment | LIRTAIISVTASFVLFGAWAVNLVSYHPAPDLNPLAPLSAPVEWK |
Ga0184640_102431002 | 3300018074 | Groundwater Sediment | MIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNPLVPLSAPVDGK |
Ga0184632_102924171 | 3300018075 | Groundwater Sediment | MIRTAIISVAASFVLFGAWTINLVSYHPANDLNPLAPLSAPID |
Ga0184609_101825562 | 3300018076 | Groundwater Sediment | MIRTAIISVTASFVLFGAWAVNLVSYHPAPDLNPLAPLSAPVDRR |
Ga0184625_100157381 | 3300018081 | Groundwater Sediment | KRSYVMIRTAIISVIASFVLVSAWTVNLVSYHPATDLNPLAPLSVDRN |
Ga0184625_100317887 | 3300018081 | Groundwater Sediment | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDWK |
Ga0184625_102612383 | 3300018081 | Groundwater Sediment | MMRTAIISVTASVVLFGAWAVNLISYHPATDLNPLAPLSAPVDWK |
Ga0184625_103753701 | 3300018081 | Groundwater Sediment | MIRTAIISVIASFVLVSAWTVNLVSYHPATDLNPLA |
Ga0193705_10883472 | 3300019869 | Soil | MIRTAIISMLASFVLVGVWTINLVSYHPATDLSPLAPLSTNFD |
Ga0193700_10347202 | 3300019873 | Soil | MEKNNGSAAMMRTAIISVTASFVLFGAWAAHLISYHPATDLNPLAPLSAPVDWN |
Ga0193722_11154582 | 3300019877 | Soil | MIRTAIISMLASFVLVGVWTINLVSYHPAADLNPIAPLSTNFD |
Ga0193723_10128635 | 3300019879 | Soil | MIRTAIISVTASFVLFGAWAVNLVSYHPAPDLNPLAPLSAPVDR |
Ga0193730_11202623 | 3300020002 | Soil | MIRTTIISVTASFVLFGAWAVNLVSYHPAPDLNPLAPLSSPVEWK |
Ga0193735_11753592 | 3300020006 | Soil | MIRTAIISMLASFVLVGVWTINLVSYHPATDLNPLAPLSMNFD |
Ga0193734_10588061 | 3300020015 | Soil | MIRTAIISMLASFVLVGVSTINLVSYHPATDLNPLAPLSMNFD |
Ga0193721_10943632 | 3300020018 | Soil | MEKNNGSAAMMRTAILSVTASFVLFGAWAAHLISYHPATDLNPLAPLSAPVDWN |
Ga0193721_11055071 | 3300020018 | Soil | MIRTAIISMLASFVLVGVCTINLVSYHPATDLNPLAPLSTNFD |
Ga0206350_110499262 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLNAPVDWK |
Ga0210381_102388472 | 3300021078 | Groundwater Sediment | MIRTAVISVTASFVLFGAWAVNLVSYHPAPNLDSLAPLSAPVDWK |
Ga0210381_102979751 | 3300021078 | Groundwater Sediment | MIRTAIISVTASFLLFGAWAVNLVSYHPAPDPNSLTPLSAPVDWK |
Ga0210402_108530512 | 3300021478 | Soil | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVDGR |
Ga0126371_1000165024 | 3300021560 | Tropical Forest Soil | MIRTVIISVTASIVLFGAWTIDLVRYHPATDLNPLAPLNTKIDWR |
Ga0126371_103968592 | 3300021560 | Tropical Forest Soil | MIRTAIISVTASFVFLGAWTVNLVSYHPAKDLNPLAPLSATTDWS |
Ga0126371_106310342 | 3300021560 | Tropical Forest Soil | MIRTAIISVIASFVLFGAWTVNLVSYHPATDLNPLAPLSTDIDWR |
Ga0126371_117478041 | 3300021560 | Tropical Forest Soil | MIRTAIISVTASFLLFGVWTANLVSYHPANDLNPLAPLHTNLGWK |
Ga0222623_100587372 | 3300022694 | Groundwater Sediment | MIRTAIISVTASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDQK |
Ga0222622_110647522 | 3300022756 | Groundwater Sediment | MIRTAIISVAASFVLVGVWAVNLVSYHSAPDLNPLAPLSAPAEWK |
Ga0207656_103848441 | 3300025321 | Corn Rhizosphere | MVRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPVDWK |
Ga0207656_106536151 | 3300025321 | Corn Rhizosphere | IISVTASFVLSGAWTINLVSYHPATDINPLAPLSASFD |
Ga0210094_10733991 | 3300025549 | Natural And Restored Wetlands | AIISMIASFVLIGAWTVNVVSYHPTTDLNPLAPLSVDWN |
Ga0210108_10418031 | 3300025560 | Natural And Restored Wetlands | MIRTAIISMIASFVLIGAWTVNVVSYHPTTDLNPLAPLSVDWN |
Ga0207692_101784291 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VVMIRTVIISVVASFALVSAWTINLVSYHPGTDLNPLAPLSVQVD |
Ga0207685_107768831 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLGTNVDRR |
Ga0207699_104302311 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SGERDCVMIRTAIISMLASFVLVGVWTINLVSYHPATDLNPIAPLSTNFD |
Ga0207693_103259174 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SVVMIRTVIISVVASFALVSAWTINLVSYHPGTDLNPLAPLSVQVD |
Ga0207657_100497991 | 3300025919 | Corn Rhizosphere | MIRTAIISVTASFVLFGAWTINLVSYHPATDMNPLAPLTASFD |
Ga0207652_109506852 | 3300025921 | Corn Rhizosphere | MIRTAIISVTASFVLFSAWTVNLVRYHPATDLNPLAPLGTDVDWR |
Ga0207650_101386613 | 3300025925 | Switchgrass Rhizosphere | MVRTAIISVTASFLLFGAWAVNLVRYHPAPNLNSLTPLSAPVDWK |
Ga0207659_103629762 | 3300025926 | Miscanthus Rhizosphere | LIRTVIISVTAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVE |
Ga0207700_108320381 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ISVVASFALVSAWTINLVSYHPGTDLNPLAPLSVQVD |
Ga0207701_100506224 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRTTIISVIASFVVFGAWIINEVSYHPAAGPNPLAPLSSNVD |
Ga0207690_111268552 | 3300025932 | Corn Rhizosphere | NGSTVMIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVD |
Ga0207690_113576062 | 3300025932 | Corn Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLST |
Ga0207706_1000926011 | 3300025933 | Corn Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVN |
Ga0207670_107643182 | 3300025936 | Switchgrass Rhizosphere | YIMIRTTIISVIASFVVFGAWIINEVSYHPAAGPNPLAPLSSNVD |
Ga0207669_110232161 | 3300025937 | Miscanthus Rhizosphere | MIRTVIISVVASFALVSAWTINLVSYHPGTDLNPLAPLSVQ |
Ga0207669_110262791 | 3300025937 | Miscanthus Rhizosphere | DKGSVGMIRTVIISVVASFALVSAWTINLVSYHPGTDLNPLAPLSVQVD |
Ga0207691_104817271 | 3300025940 | Miscanthus Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVRYHPATDLNPLAPLSTDIA |
Ga0207689_100769592 | 3300025942 | Miscanthus Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPVTDMNPLAPLTASFD |
Ga0207661_115425342 | 3300025944 | Corn Rhizosphere | MIRTAIISVTASFVLFGAWTINLVSYHPATDINPLAPLSAS |
Ga0207712_104455822 | 3300025961 | Switchgrass Rhizosphere | LIRTVIISVTAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVEWN |
Ga0210078_10121612 | 3300025979 | Natural And Restored Wetlands | MIRTAIITVTASFVLFAAWTVNLVSYHPANDLNPLAPLSV |
Ga0210078_10193483 | 3300025979 | Natural And Restored Wetlands | GMIRTAIVSVIGSFLLVGAWTANLVSYHPTADLDPLAPLSVHID |
Ga0210078_10296692 | 3300025979 | Natural And Restored Wetlands | MIRTAIISVIASFVLVGAWTANLVSYHPATDLDPLTPISVDWK |
Ga0207677_116367222 | 3300026023 | Miscanthus Rhizosphere | LIRTVIISVTAAFVLFSAWAINLVSYHPAPDLNRLAQLSAP |
Ga0207677_119049602 | 3300026023 | Miscanthus Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTN |
Ga0207648_100463773 | 3300026089 | Miscanthus Rhizosphere | MIRTAIISVTASFVLFGAWTVNLVRYHPATDLNPLAPLGTDVDWR |
Ga0207648_110290112 | 3300026089 | Miscanthus Rhizosphere | LIRTVIISVTAAFVLFSAWAINLVSYHPAPDLNRLAQLSAPVEWN |
Ga0256801_10003904 | 3300026362 | Sediment | MILTAIISVIASFVLVGAWTANLVSYHPATDLDPLTPISVDWK |
Ga0256814_10056202 | 3300026464 | Sediment | MMRTVLISITASFVLVGAWTINLVSYHPAKDLNPLAPLKTTLIVKQ |
Ga0207826_10359772 | 3300027680 | Tropical Forest Soil | VIRTAIISITASFVLFGAWAVNLVSYHPATDLNPLAPLSAPVDWK |
Ga0209814_101395401 | 3300027873 | Populus Rhizosphere | MIRTAIISVIVSFVLVSAWTVNLVSYPPATDLNPLAPVSIDWN |
Ga0209814_105470842 | 3300027873 | Populus Rhizosphere | TMIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLNAPVDGK |
Ga0209465_103229232 | 3300027874 | Tropical Forest Soil | MIRTAIVSVTASFVLFGAWAVNLVSHHPATDLIPLAPLNAPVDWK |
Ga0209481_102093592 | 3300027880 | Populus Rhizosphere | MIRTAIVSVTASFVLFGAWAVNLVSYHPATDLNPLAPLNAPVDGK |
Ga0209481_102816602 | 3300027880 | Populus Rhizosphere | MIRTAIASVTASFVLFGAWAVNLVSYHPATDLNPLAPLSALVDWK |
Ga0209481_104040111 | 3300027880 | Populus Rhizosphere | MIRTAIISVIVSFVLVSVWTVNLVSYPPATDLNPLAPVSIDWN |
Ga0209068_100070214 | 3300027894 | Watersheds | MIRTAIISVVASFVLVGAWTVSLVSYHPATDLKPLASLSTNVE |
Ga0209068_100438793 | 3300027894 | Watersheds | MIRTAIISVTASFVLFGAWTANLVSYHPAKDLNPMTPLSTTVEWR |
Ga0207428_10000058127 | 3300027907 | Populus Rhizosphere | MIRTAIISVTASIVLIGAWTINLVSYHPTIDLNPLAPLNAPVDWK |
Ga0207428_1000358722 | 3300027907 | Populus Rhizosphere | MIRTAIVSVTASFVLFGAWAVNLVTYHPATDLNPLAPLNAPVDWK |
Ga0209583_100299514 | 3300027910 | Watersheds | MIRTAIISVTASFVLFGAWTVNLVSYHPAKDLNPMAPLSTTVEWR |
Ga0209583_101600721 | 3300027910 | Watersheds | MMRTVLISITASFVLVGAWTINLVSYHPAKDLNPLAPLKTTVIVKQ |
Ga0209583_102151382 | 3300027910 | Watersheds | MIRTAIISVTASFVLFGAWTANLVSYHPATDINPLAPLSTTEWR |
Ga0209069_100661292 | 3300027915 | Watersheds | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSATFD |
Ga0209069_107053501 | 3300027915 | Watersheds | MIRTAIISVTASFVLFGVWTANLVSYHPAKDLNPMAPLSTTVEWR |
Ga0268264_104851153 | 3300028381 | Switchgrass Rhizosphere | MIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLSPLNAPVDWK |
Ga0307293_101964911 | 3300028711 | Soil | NPGKRDCVMIRTAIISMLASFVLVGVWTINLVSYHPATDLNPLAPLNTNFD |
Ga0307301_103002761 | 3300028719 | Soil | MIRTAIISVTASFVLFGAWAVNLVSYHPAADLNPLAPLSAPVDRR |
Ga0307282_100700051 | 3300028784 | Soil | TASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPADWK |
Ga0307282_101023031 | 3300028784 | Soil | MMRTAIISVTASFVLFGAWAAHLISYHPETDLNPLAPLSA |
Ga0307282_101416842 | 3300028784 | Soil | MIRTAIISMLASFVLVGVCTINLVSYHPATDLNLLAPLSTNFD |
Ga0307282_106611263 | 3300028784 | Soil | MIRTAVISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPVDW |
Ga0307323_102045731 | 3300028787 | Soil | IISMLASFVLVGVWTINLVSYHPATDLNPIAPLSTNFD |
Ga0307290_103486132 | 3300028791 | Soil | MIRTAIISMLASFVLIGVSTINLVSYHPATDLSPLAPLSTNFD |
Ga0307504_101438402 | 3300028792 | Soil | MIRTAIISVTASFVLFGAWTVNLVSYHPANDLNPLAPLNTNVGWK |
Ga0307299_102343751 | 3300028793 | Soil | MIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPA |
Ga0307299_104139291 | 3300028793 | Soil | MIRTAIISVAASFVLVGVWAINLVSYHSEPDLNPLAPLSA |
Ga0307287_101532602 | 3300028796 | Soil | MIRTAIISVTASFVLFGAWAVNLVSYHPAPNLNPLVPLSASVDGK |
Ga0307287_104134242 | 3300028796 | Soil | MIRTAIISVTASFVLFGAWAVNLVSYHPAADLNPLAPLSAPVDR |
Ga0307305_102407411 | 3300028807 | Soil | MIRTAVISVTASFLLFGAWAVNLVSYHPAPNLNSLA |
Ga0307292_101553651 | 3300028811 | Soil | MIRTAIISMLASFVLVGVWTINLVSYHPATDLNPLAPLNTNFD |
Ga0307302_103335412 | 3300028814 | Soil | MIRTAIISVTASFVLFDAWAVNLVSYHPAPDLNPLAPLSAPVDQ |
Ga0307302_103532662 | 3300028814 | Soil | MIRTAIISVTASFVLFGAWAINLASYHPAADLNPLAPLSAPVDR |
Ga0307302_106151291 | 3300028814 | Soil | NRSSAMIRTAIISVTASFVLFGAWAVNLVSYHPAPDLNPLAPLSAPIDWK |
Ga0307296_100662313 | 3300028819 | Soil | MIRTTIISVTASFVLFGAWAVNLVSYHPAPNLNPLVPLSASVDGK |
Ga0307296_102180033 | 3300028819 | Soil | MIRTAIISVAASFVLVGVWAVNLVSYHSAPDLNALPPLSAPAEWK |
Ga0307312_101675261 | 3300028828 | Soil | MIRTAVISVTASFLLFGAWAVNLVSYHPAPNLNSLAPLSAP |
Ga0307312_106955022 | 3300028828 | Soil | GKRDCVIIRTAIISMLASFVLVGVWTINLVSYHPATDLNPLAPLNTNFD |
Ga0307312_108514391 | 3300028828 | Soil | TAIISVTASFVLFGAWAAHLISYHPETDLNPLAPLSAPVDWN |
Ga0308203_10081372 | 3300030829 | Soil | MIRTAIISVTASFVLFGAWAVNLVSYHSAPDLNPLAPLSAPAEWK |
Ga0308203_10091792 | 3300030829 | Soil | MIRTAVISVTASFVLFGAWAVNLVSYHPAPNLNPLVPLSASVDGK |
Ga0308203_10255932 | 3300030829 | Soil | MIRTAIISVAASFVLFGVWAANLVSYHSAPDLNPLAPLSAPAEWK |
Ga0308202_10167881 | 3300030902 | Soil | KLAKLTESSAMIRTAIISVAASFVLFGVWAANLVSYHSAPDLNPLAPLSAPAEWK |
Ga0308206_10701223 | 3300030903 | Soil | MIRTAIISVAASFVLFGAWAVNLVSYHSAPDLNSLAPLSAPAEWK |
Ga0308206_10937702 | 3300030903 | Soil | MIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLSAPADWK |
Ga0075386_100552772 | 3300030916 | Soil | MIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLSPLSAPLDWK |
Ga0075386_113663952 | 3300030916 | Soil | VIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVDGR |
Ga0075386_121781883 | 3300030916 | Soil | MIRTTIISVTASFVLFGAWAVNLVSYHPAPDLNPLAPLSAPVDGK |
Ga0075373_115249362 | 3300030945 | Soil | MIRTAIISVTASFVLFGAWAVNLVSYHPAPNLNPLVPLSAPVDGK |
Ga0308196_10405681 | 3300030989 | Soil | MIRTTIISVTASFVLFGAWAVNLVSYHPAPNLDSLAPFSAPVDWK |
Ga0170834_1126145493 | 3300031057 | Forest Soil | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLTTNVDWR |
Ga0308189_102703642 | 3300031058 | Soil | MIRTTIISVTASFVLFGAWAVNLVSYHPAPNLNPLVPLSAPVDGK |
Ga0308192_10658282 | 3300031082 | Soil | MIRTAVISVTASFLLFGAWAVNLVSYHPAPNLNPLVPLSASVDGK |
Ga0308201_103730542 | 3300031091 | Soil | MIRTAIISVTASFLLFGAWAVNLVSYHPAPDLTPLAPLSAPVEWK |
Ga0308204_102702131 | 3300031092 | Soil | SSAMIRTAIISVAASFVLVGVWAVNLVSYHSAPDLNALPPLSAPAEWK |
Ga0308197_100766481 | 3300031093 | Soil | MIRTAVISVTASFLLFGAWAVNLVSYHLAPNLNSLTPLSAPVDWK |
Ga0308197_102871072 | 3300031093 | Soil | MIRTTIISVTASFVLFGAWAVNLVSYHPATNLNPSGPAQRFC |
Ga0308199_11697002 | 3300031094 | Soil | MIRTAVISVTASFVLFGAWAVNLVSYHPAPNLNPLVPLSAPVDGK |
Ga0307498_100161982 | 3300031170 | Soil | MIRTAIISVTASFVLFGGWAVNLVSYHPAADLNPLAPLSAPVDRR |
Ga0307498_101042142 | 3300031170 | Soil | MIRTAIISVTASFVLFGAYAVNLVSYHPAPDLNPLAPLSAPVDWR |
Ga0307498_101238311 | 3300031170 | Soil | MIRTAVISVTASFVLFGAWAVNLVSYQPAPNLDSLAPLSAPVDWK |
Ga0307498_101489121 | 3300031170 | Soil | PRKRDCVMIRTAIISMLASFVLVGVWTINLVSYHPATDLNPIAPLSTNFD |
Ga0307498_104880641 | 3300031170 | Soil | MIRTAIISMLASFVLVGVWTINLVSYHPAIDLNPIAPLSTNFD |
Ga0307495_100102992 | 3300031199 | Soil | REAVMIRTAIISVTASFVLFGAWTVHLVSYHPTSDLNPLAPLITSID |
Ga0307497_100311781 | 3300031226 | Soil | MIRTAIISVTASFVLFGGWAVNLVSYHPAADLNPLAPLSAPVGR |
Ga0307497_100397961 | 3300031226 | Soil | MIRTAIISMLASFVLIGVSTINLVSYHPATDLNPLAPLSTNFD |
Ga0307497_101203951 | 3300031226 | Soil | VISVTASFVLFGAWAVNLVSYQPAPNLDSLAPLSAPVDWK |
Ga0170824_1111716422 | 3300031231 | Forest Soil | MIRTAIISVTASFVLFGAWAVNMVSYHPAPDLNPLAPLSAPVDRK |
Ga0170824_1215739233 | 3300031231 | Forest Soil | CVMIRTAIISMLASFALVGVWTINLVSYHPAADLNPIAPLSTNFD |
Ga0170824_1280336445 | 3300031231 | Forest Soil | MIRTAIISVTASFVLFGAWTVHLVSYHPTTDLNPLAPLITSID |
Ga0170820_161587381 | 3300031446 | Forest Soil | MRTILVSIAASFVLVSAWTINLVSYHPTNDLNPLAPLKTTV |
Ga0318541_100358895 | 3300031545 | Soil | MIRTAIVSVTASFVLFGAWAVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0310887_100100843 | 3300031547 | Soil | MIRTAIISVTASFVLFGAWTVNLVSYHPATDMNPLAPLTASFD |
Ga0310915_102066233 | 3300031573 | Soil | MIRTAIISMTASFVLFGAWTVNLVSYHPATDLNPLAPLSTDIDRR |
Ga0318561_103411181 | 3300031679 | Soil | MIRTALVSVTASFVLFGAWAVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0310813_118862891 | 3300031716 | Soil | MIRTAIISLTACFVLFGAWTVNLVSYHPATDLKPLAPLSHSVEWR |
Ga0310813_119708102 | 3300031716 | Soil | MIRTAIISVTASFVLFGAWTVNLVSYHPATDLNPLAPLSTNVDWR |
Ga0307469_100746251 | 3300031720 | Hardwood Forest Soil | MIRTAIISVTASFVLFGAWTVNLVSYHPANDLNPLAPLNTNVDWR |
Ga0307468_1002277744 | 3300031740 | Hardwood Forest Soil | MIRTAIISVTASFLLFGAWAVNLVSYHPAPNLNSLTPLS |
Ga0307468_1018055892 | 3300031740 | Hardwood Forest Soil | MIRTAIVSATASFVLFGAWAVNLFRYHPATDLKPLAPLSAPVDRK |
Ga0306918_100296735 | 3300031744 | Soil | VIRTAIISITASFVLFGAWAVNLVSYHPATDLNPLAPFSAPVDWK |
Ga0318494_105774661 | 3300031751 | Soil | SVTASFVLFGAWAVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0318535_101449222 | 3300031764 | Soil | MIRTALVSVTASFVLFGAWEVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0307473_114212581 | 3300031820 | Hardwood Forest Soil | MIRTAIVSVIASVVLVSAWTVNLVSYHPATDLNPLAPLSTNVDWK |
Ga0310917_1000211510 | 3300031833 | Soil | GSTAMIRTAIVSVTASFVLFGAWAVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0310892_105711072 | 3300031858 | Soil | MIRTTIISVIASFVVFGAWIINEVSYHPAAGPNPLAPLS |
Ga0306919_108346691 | 3300031879 | Soil | GSTAMIRTALVSVTASFVLFGAWAVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0318544_102012721 | 3300031880 | Soil | IVSVTASFVLFGAWAVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0318544_104151421 | 3300031880 | Soil | AIVSVTASFVLFGAWAVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0310900_106772982 | 3300031908 | Soil | LIRTVVISVTAAFVLFGAWAINLVSYHPAPDLNRLAQLSAPVEWN |
Ga0306921_122725642 | 3300031912 | Soil | VTASFVLFGAWAVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0310891_100011134 | 3300031913 | Soil | MIRTAIVSVTASFVLFGAWTVNLVSYHPVTDMNPLAPLTASFD |
Ga0310885_100531792 | 3300031943 | Soil | LIRTVIISVTAAFVLFSAWAINLVSYHPAPDLNRLAQLSAPLE |
Ga0310913_112993881 | 3300031945 | Soil | MIRTAIISVVASFALVSAWTVNLVSYHPGTDLNPLAP |
Ga0310903_104038561 | 3300032000 | Soil | MIRTTIISVIASFVVFGAWIINEVSYHPAAGPNPLAPL |
Ga0318569_105511121 | 3300032010 | Soil | MIRTAIVSVTASFVLFGAWAVNLVSHHPATDLIPLAPLNAPVGWK |
Ga0310890_104394421 | 3300032075 | Soil | VTAAFVLFSAWAINLVSYHPAPDLNRLAQLSAPVEWN |
Ga0306924_111180132 | 3300032076 | Soil | MIRTAIISVVASFALVSAWTVNLVSYHPGTDLNPLAPLSVQVEQIADYDHM |
Ga0310895_101436622 | 3300032122 | Soil | MIRTVVISVTAAFVLLGAWAINLVSYHPAPDLNRLAQLSAPVEWN |
Ga0307471_1009071532 | 3300032180 | Hardwood Forest Soil | MIRTAIISFTASFVLFGAWTVNLVSYHPANDLNPLAPLSTNVRWK |
Ga0307471_1034773761 | 3300032180 | Hardwood Forest Soil | VMIRTAIISVTASFVLFGAWTVNLVSYHPANDLNPLAPLNTNVDWR |
Ga0307471_1037157663 | 3300032180 | Hardwood Forest Soil | MIRTAIVSVAASFILFGAWAVNLVSYHPATDLTPLARLNAPVDWK |
Ga0307472_1012013543 | 3300032205 | Hardwood Forest Soil | LIRTVIISATAAFVLFGAWAINLVSYHPAPDLNRL |
Ga0306920_10005001412 | 3300032261 | Soil | TALVSVTASFVLFGAWAVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0335082_100477934 | 3300032782 | Soil | MMRTVLISITASFVLVGAWTINLVSYHPANDLNPLAPLKTTSIVKQ |
Ga0335082_102652332 | 3300032782 | Soil | MIRTAIISVTASFVLFGVWTANLVSYHPATDLNPLAPLSTTEWR |
Ga0335079_104413513 | 3300032783 | Soil | MIRTAIISVTASFVIFGVWTASLVSYHPAKDLNPLAPLNTTIDWK |
Ga0318519_109665111 | 3300033290 | Soil | SGSTAMIRTAIVSVTASFVLFGAWAVNLVSHHPAPDLNPLAPLNAPVDWK |
Ga0310810_101596684 | 3300033412 | Soil | MIRTAIISVTASFVLFGAWTVNLVRYHPATDLNPLAPLSTDVDWR |
Ga0310810_101878871 | 3300033412 | Soil | MIRTAIITVTASFVLFGAWTVNLVSYHPAKDLNPLAPLGTSVDWK |
Ga0326726_100881342 | 3300033433 | Peat Soil | MIRSAIISMVASFVLVGAWTVSLVSYRPATDLNPLAPLSTNVE |
Ga0326726_108757351 | 3300033433 | Peat Soil | MIRTAIISVSASFVLFGVWTANLVSYHPATDLNPLAPLSTTEWR |
Ga0326726_109367553 | 3300033433 | Peat Soil | MMRTAIISVTASVVLFGAWAVNLISYRPAADLNPLAPLSAPVDWK |
Ga0326726_114820142 | 3300033433 | Peat Soil | MIRTAIISMVASFVLVGAWTVSLVSYHPATDLNPLAPLSTNVE |
Ga0326726_114911931 | 3300033433 | Peat Soil | MIRTAIISVVASFVLVGVWTVNLVSYHPATDLKPLASLSTNVE |
Ga0326726_121498672 | 3300033433 | Peat Soil | MIRTAIIFVIASFVLVGVWTANLVSYHPATDLDPLAPLRVNWN |
Ga0326730_10303072 | 3300033500 | Peat Soil | MIRTAIISVAASFVLFGVWTANLVSYHPATDLNPLAPLSTTEWR |
Ga0326730_10415922 | 3300033500 | Peat Soil | PGKNKGSTVMIRTAIISVTASFVLFGAWTANLVSYHPATDINPLAPLSTTEWR |
Ga0326723_0027154_1715_1846 | 3300034090 | Peat Soil | MVRTTIISVIVSFVVVVVWTVNLVSYHPATHLNPLAPFGTNID |
Ga0326723_0033033_651_785 | 3300034090 | Peat Soil | MIRTAIISVTASFVLFGAWTVNLVSYHPANDLNPLAPLSKSVRK |
Ga0326723_0101386_1106_1243 | 3300034090 | Peat Soil | MIRTTIISVIVSFVVFGVWTVNLVSYHPATDLNPLAPLGSNVDWK |
Ga0326723_0133169_360_491 | 3300034090 | Peat Soil | MIRTAIISIAASFVLVGVWTISLVSYHPTTDLNPLAPLSTSVD |
Ga0326723_0214369_200_331 | 3300034090 | Peat Soil | MIRTAIISVVASFVLVGAWTVSLVSYHPATDLNPLAPLSTNVE |
Ga0326723_0401174_489_623 | 3300034090 | Peat Soil | IRTTIISVIVSFVVVGAWTVNLVSYHPAADLNPLAPFGTNVDWK |
Ga0373948_0004562_1693_1824 | 3300034817 | Rhizosphere Soil | MIRTAIISVTASFVLFGAWTINLVSYHPATDINPLAPLNASFD |
⦗Top⦘ |