NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LWFCAnN_GO09JKT02F6GS1

Scaffold LWFCAnN_GO09JKT02F6GS1


Overview

Basic Information
Taxon OID2088090007 Open in IMG/M
Scaffold IDLWFCAnN_GO09JKT02F6GS1 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - from flow sorted anaerobic plus nitrate
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)527
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location
Location NameLake Washington, Seattle, Washington, USA
CoordinatesLat. (o)47.63Long. (o)-122.27889Alt. (m)Depth (m)62
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080201Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
LWFCAnN_04820300F080201N/AICNNCGIVLDDTPTFESYTHWTPEWHSNWNEQDSETLKEWLTTLRTVSCQLNIPNFPYKEEAARTIRTQNHVLFRSQKLSKNKRVTVAALMYLVLKEYDKKRSIKEISKELSLDNKSVMKQAWIISKTLNGEKTQLKNQRKTSLDYLYENGGKITTNKDLIQSAEKTLMKIKRSG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.