NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LWFCAnN_GO09JKT01C04O5

Scaffold LWFCAnN_GO09JKT01C04O5


Overview

Basic Information
Taxon OID2088090007 Open in IMG/M
Scaffold IDLWFCAnN_GO09JKT01C04O5 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - from flow sorted anaerobic plus nitrate
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)529
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location
Location NameLake Washington, Seattle, Washington, USA
CoordinatesLat. (o)47.63Long. (o)-122.27889Alt. (m)Depth (m)62
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043810Metagenome155Y

Sequences

Protein IDFamilyRBSSequence
LWFCAnN_09228590F043810N/AKETWQFELQNSKEIDVTLDIRRNFPGDWDLKTDAPHENVDAHKVKFVLPLTSRAKQKFTYELTTRLGTNATK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.