Basic Information | |
---|---|
Taxon OID | 2077657018 Open in IMG/M |
Scaffold ID | ASA120_GJFD58A02F0Z6Z Open in IMG/M |
Source Dataset Name | Marine sediment archaeal communities from Santa Barbara Basin, CA, that are methane-oxidizing, sample 0-3 cm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 500 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Santa Barbara Basin, Ca, That Are Anaerobic And Methane-Oxidizing |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Santa Barbara Basin | |||||||
Coordinates | Lat. (o) | 34.21 | Long. (o) | -119.5 | Alt. (m) | Depth (m) | to .03 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035021 | Metagenome / Metatranscriptome | 173 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ASA120_02355310 | F035021 | GGAGG | MLAIRVAVDDATCVPGLMRRLARLFDRSSISFDRSRREVRVESEWGSRSVVSVIDAVAGWLAEDGGSSATLSIGDRSYTLAGPTPLVRP |
⦗Top⦘ |